KEGG   Sorangium cellulosum So ce56: sce8725Help
Entry
sce8725           CDS       T00634                                 

Gene name
aceB
Definition
(GenBank) High confidence in function and specificity
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00620  Pyruvate metabolism
scl00630  Glyoxylate and dicarboxylate metabolism
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01200  Carbon metabolism
Module
scl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    sce8725 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    sce8725 (aceB)
Enzymes [BR:scl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     sce8725 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CAN98896
UniProt: A9G4E5
Position
12175483..12177105
Genome map
AA seq 540 aa AA seqDB search
MSQNHETASVRLLAPRVGGDESVLTPEALRFLSGLGRKFADRVPALLARRRAVQERLDAG
ERFDFLPETRDVREGDWTVAPLPEDLLDRRVEITGPVDPKMIINALNSGASVFMADFEDA
TSPTWKNLIEGQAALRLAARRELRYDDPATGKRYALGDRLATLLVRPRGWHLPERHVELD
GKPLPGGLFDFGLYFFHNARELVRRGTGPYFYLPKMESHLEARLWNDVFVFAQEALGLPI
GTIKATVLIETLPAAFEMDEILHELRQHSAGLNCGRWDYIFSFIKKLRNDPACVMPDRSQ
VTMEQHFLRSYTQLLVKTCHRRGVHAMGGMAAQIPIKSDPEANRAALDKVRADKLREVKD
GHDGTWVAHPGLVPLAREVFDAHMPAANQIERKREDVRVSAADLLRVPEGARTEAGLRHN
IRVGVQYLEAWISGLGCVPLYNLMEDAATAEISRTQVWQWIRHGATLDDGQPLTVERFRA
AVDGEMAALRGALGPARFDGGRFAEARALFERLSIGETFEEFLTLPAYELLISSAGERRS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaatcatgagaccgcaagcgtccgcttgctcgctcctcgggtcgggggcgac
gagtccgtcctcacgccagaggcccttcgtttcctctccggtcttgggcgcaagttcgct
gaccgggtgcccgccctgctcgcccggcggcgcgccgtgcaagagcggctggacgcgggc
gagcggttcgattttctccccgagacgcgggatgtgcgcgagggcgactggacggtggcg
ccgctgcccgaggacctcctcgaccggcgcgtggagatcacgggtccggtcgatcccaag
atgatcatcaacgcgctgaactcgggcgcgagcgtgttcatggccgacttcgaggacgcc
acgtcgcccacgtggaagaacctcatcgaggggcaagcggcgctgaggctcgcggcgcgg
cgcgagctccggtacgacgacccggcgaccggcaagcgttacgccctcggagacaggctg
gcgacgctgctcgtgcgcccgcgcggctggcacctccccgagaggcacgtcgagctcgac
ggcaagccgctgccaggcgggctcttcgatttcggactctatttcttccacaacgcgcgt
gagctcgtccgccgcggtaccgggccttacttctatctgccgaagatggagagtcacctg
gaggcgcgcctctggaacgacgtcttcgtgttcgcgcaggaggcgctcggcctccccatc
ggcacgatcaaggccacggtcctcatcgagacgctgcccgcggcgttcgagatggacgag
atcctccacgagctccggcagcactcggccggcctcaactgcggtcgctgggactacatc
ttcagcttcatcaagaagctccggaacgaccccgcctgcgtgatgccggaccgctcgcag
gtgacgatggagcagcatttcctgcgctcgtacacgcagctgctcgtgaagacgtgccac
cgccgcggcgtccacgcgatgggcggcatggcggcgcagatcccgatcaagagcgacccg
gaggcgaaccgcgcggcgctcgacaaggtgcgcgccgacaagctgcgcgaggtgaaggac
ggacacgacggcacctgggtcgcgcacccggggctcgtgccgctcgcgcgcgaggtgttc
gacgcgcacatgcccgctgcgaaccagatcgagcgcaagcgcgaggacgtccgcgtctcg
gcggccgacctgctgcgcgtcccggagggcgcgcgcaccgaggccggcctgcgccacaac
atccgggtcggcgtccagtacctcgaggcgtggatcagcgggctcggctgcgtcccgctc
tacaacctgatggaggacgcggccaccgcggagatctcccgcacccaggtctggcaatgg
atccgccacggggcgacgctcgacgacggccagccgctcaccgtggagcgcttccgcgcg
gcggtggacggcgagatggccgccctccgcggcgcgctcggcccggcgcgcttcgacggc
ggccgcttcgccgaggcgcgcgcgctgttcgagcggctgtcgatcggagagaccttcgag
gagttcctcacgctgcctgcttacgagctcttgatctccagcgccggagagcggcgctcg
tga

DBGET integrated database retrieval system