KEGG   Sorangium cellulosum So ce56: sce9142Help
Entry
sce9142           CDS       T00634                                 

Gene name
sucC
Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00020  Citrate cycle (TCA cycle)
scl00640  Propanoate metabolism
scl00660  C5-Branched dibasic acid metabolism
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01130  Biosynthesis of antibiotics
scl01200  Carbon metabolism
Module
scl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    sce9142 (sucC)
   00640 Propanoate metabolism
    sce9142 (sucC)
   00660 C5-Branched dibasic acid metabolism
    sce9142 (sucC)
Enzymes [BR:scl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     sce9142 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAN99315
UniProt: A9GD65
Position
complement(12732779..12733975)
Genome map
AA seq 398 aa AA seqDB search
MKIHEYQGKQLFARYGVPVPKGEPAFQASEVAPIADRLIAQTGNPVVVVKAQIHAGGRGK
GGGVKVAKGGSAEATALAEKILGMQLVTKQTGPEGQKVRRLYIEQGLDIARELYFAMLVD
RERRRIAVIASTEGGMDIEEVAHSTPEKIYKLFIDPVLGLAPYQGRQLAIALGLTAKETQ
RQFLKLVASLYACFTAEDCSLLEINPLVVTGAGDVFALDAKVSFDDNAEFRHADWNGMRD
VDEEDPVELQAKRAGLSYVSLDGDIGCLVNGAGLAMATMDIILHYGGKPANFLDVGGGAS
QEQVKTAFQIILRSERVRGIFVNIFGGIMRCDVVAAGVIAAAKELGLKVPLVVRLEGTNV
EAGRKLLDESGLTIQSASSMADGAQKIVAATRGGKAGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccacgagtatcaaggcaagcagctcttcgctcgctacggagtgccggtaccg
aaaggggagcccgctttccaggcgagtgaggtggcgccgatcgccgatcggctgatcgcc
cagacaggcaacccggtcgtcgtcgtgaaggcgcagatccacgcgggcggccgcggcaag
ggcggcggcgtcaaggtcgcgaagggtggcagcgcggaggcgaccgccctcgccgagaag
atcctcggcatgcagctcgtcaccaagcagacgggccccgaggggcagaaggtccgacgg
ctctacatcgagcagggcctcgacatcgcgcgcgagctctacttcgcgatgctcgtcgat
cgcgagcgccgccgcatcgcggtgatcgcctcgaccgagggcggcatggacatcgaggag
gtggcccacagcacgccggagaagatctacaagctcttcatcgatccggtgctcggcctc
gccccgtaccaggggcggcagctcgcgatcgcgctcgggctcaccgcgaaggagacgcag
cgccagttcctgaagctcgtggcctcgctctatgcgtgcttcaccgcggaggactgctcg
ctgctcgagatcaacccgctcgtcgtgaccggcgccggcgacgtcttcgcgctcgacgcg
aaggtgagcttcgacgacaacgccgagttccggcacgccgactggaacgggatgcgcgac
gtcgacgaggaggatccggtcgagctgcaggcgaagcgggccgggctgtcctacgtgtcg
ctcgacggcgacatcggctgcctcgtgaacggcgccgggctcgcgatggcgacgatggat
atcatcctccattacggcggaaagccggcgaacttcctggacgtcggcggcggcgcctcg
caggagcaggtgaagaccgcgttccagatcatcctccggagcgagcgggtccgcggcatc
ttcgtgaacatcttcggcggcatcatgcgctgcgacgtcgtcgcggccggggtcatcgcc
gcggcgaaggagctcgggctcaaggtgcctctcgtggtgcgcctcgaggggacgaacgtc
gaggccggccgcaagctgctcgacgagagcggcctgaccatccagtcggcgagctccatg
gccgacggcgcgcagaagatcgtggccgccacgcgcggcggcaaggccggcgcctag

DBGET integrated database retrieval system