KEGG   Sorangium cellulosum So ce56: sce9206Help
Entry
sce9206           CDS       T00634                                 

Gene name
thrC
Definition
(GenBank) Family membership
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00260  Glycine, serine and threonine metabolism
scl00750  Vitamin B6 metabolism
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01230  Biosynthesis of amino acids
Module
scl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    sce9206 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    sce9206 (thrC)
Enzymes [BR:scl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     sce9206 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HTH_27
Motif
Other DBs
NCBI-ProteinID: CAN99379
UniProt: A9GDN5
Position
12824677..12826017
Genome map
AA seq 446 aa AA seqDB search
MAYSAAFRCLTGCAGSYPLTQPLYRCPTCGGLLDVAHDVDALRDRSPATWMKLFDERYKR
TVWPYGSGVWGKREWVAPEVPDEAIVSMDEGGSNLFWADRYGRTLGLDDVWVKLCGNSHT
GSFKDLGMTVLVSVVNKAIREGLEVRAIACASTGDTSASLAAYGAAAGLPVVVLLPRGKV
STAQLVQPIASGALVLSLDTDFDGCMAIVQRLSADGVVYLANSMNALRLEGQKTVAIEIV
QQFDWTLPDWVILPSGNLGNAYALYAGFKMLKDLGLTTRFPRLCVAQAARANPLFKAWSE
GRSEVVPMKAGETLASAIQIGNPVSAPRAMLALKAMDGVAEEVTEDELCDAAARADRTGM
YTCPHTAVALAALEKLVKKGLVEKRQRVVVVSTANGLKFTEFKVKYHERALADVTSRLAN
PPVELPPDYDRVLAALDRHAAQTGKR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcctactctgctgcattccgatgcctgaccggttgtgccggcagctacccgctgacg
cagcccctctaccgttgccccacctgcggcggcctgctcgacgtcgcccacgacgtcgac
gcgctccgtgaccggagccccgcgacgtggatgaagctcttcgacgagcgctacaagcgc
acggtgtggccctacggctccggggtctggggcaagcgggagtgggtcgcgcccgaggtc
ccggacgaggccatcgtgtcgatggacgagggcggctcgaacctgttctgggcggaccgc
tacggccgcacgctcgggctcgatgacgtctgggtgaagctctgcggcaacagccacacg
gggtcgttcaaggacctcggcatgacggtgctcgtctcggtggtgaacaaggcgatccgc
gagggcctcgaggtgcgcgcgatcgcgtgcgcgtcgacgggggacacctcggcgtcgctc
gcggcgtacggggcggctgccggcttgcccgtggtcgtgctgcttccgcggggcaaggtg
tcgacggcgcagctcgtccagccgatcgcgtcgggggcgctggtcctctcgctggacacc
gacttcgacggctgcatggccatcgtgcagcgcctctcggccgacggcgtcgtctacctg
gcgaactcgatgaacgccctgcggctcgagggccagaagaccgtggccatcgagatcgtg
cagcagttcgactggacgctgcccgactgggtcatcctcccgagcggcaacctcggcaac
gcctacgccctctacgcgggcttcaagatgctgaaggacctcggcctgacgacgcggttc
ccgcgcctctgcgtggcgcaggcggcgcgggccaacccgctcttcaaggcgtggtccgag
gggcggagcgaggtcgtgccgatgaaggcgggggagaccctggcgagcgcgatccagatc
ggcaacccggtgagcgcgccgagggcgatgctggccctcaaggcgatggacggcgtcgcg
gaggaggtcaccgaggacgagctctgcgacgcggcggcccgcgccgatcgcaccggcatg
tacacctgcccgcacacggcggtcgccctcgccgcgctggagaagctcgtgaagaagggc
ctcgtcgagaagcgccagcgggtcgtcgtggtctcgaccgcgaacggcctcaagttcacg
gagttcaaggtgaaataccacgagcgcgcgctcgcggacgtgacgagccggctcgccaac
ccgccggtcgagctgccgcccgactacgaccgcgtcctcgccgccctcgacaggcacgcc
gcgcagaccggcaagcgctga

DBGET integrated database retrieval system