KEGG   Sorangium cellulosum So ce56: sce9342
Entry
sce9342           CDS       T00634                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
scl  Sorangium cellulosum So ce56
Brite
KEGG Orthology (KO) [BR:scl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:scl02044]
    sce9342
Secretion system [BR:scl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   sce9342
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAN99515
UniProt: A9GHL7
Position
complement(12990628..12991134)
AA seq 168 aa
MAESKQQWLSRNRPPRVQITYDVETGGAIEKKEIPFVVGIMTDLSGTSEAPRPKLKDRKF
VEIDRDNFNEVLAAVAPEATCLVDNKLTDEGGKLKVSLSFKSMDDFRPEQLVEQVEPLRA
LLRARERLNDLLAKLEGNDDLSGMLRQVVEDTKKLETLKQELEKGRGG
NT seq 507 nt   +upstreamnt  +downstreamnt
atggcagagagcaagcaacaatggctgagcaggaaccgcccgcctcgggtgcagatcacc
tacgacgtcgagaccggcggcgcgatcgagaagaaggagatcccgttcgtcgtcgggatc
atgacggacctgtcgggcacctccgaggcgccgcggccgaagctcaaggaccgcaagttc
gtcgagatcgatcgcgacaacttcaacgaggtcctcgccgcggtggcgcccgaggccacg
tgcctcgtcgacaacaagctcacggacgagggcggcaagctgaaggtcagcctctccttc
aagagcatggatgacttccggcccgagcagctcgtggagcaggtcgagccgctgcgcgcg
ctgctccgcgcgcgggagcggctgaacgatctgctcgcgaagctcgagggcaacgacgat
ctgagcgggatgctcaggcaggtcgtcgaggacacgaagaagctcgagacgctcaagcag
gagctcgagaagggccggggcggctga

DBGET integrated database retrieval system