KEGG   Sorangium cellulosum So ce56: sce9346Help
Entry
sce9346           CDS       T00634                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
scl  Sorangium cellulosum So ce56
Brite
KEGG Orthology (KO) [BR:scl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:scl02044]
    sce9346
Secretion system [BR:scl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   sce9346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: CAN99519
UniProt: A9GHM7
Position
complement(12997151..12998494)
Genome map
AA seq 447 aa AA seqDB search
MRRPAEVPAAVQWHDGMLLSPQHFQEAARRSERLLDYHLGQLHPFHYGVHHLEIDAGLLA
SGTLRVLEVEAVLPDHLVVHHTARDPELQVDLKPHAAELAAGPLTAYLAVPKEHLGGAAT
GGDLARYRSIEGAPVPDDNTGEEPLPIPRLVPVARLLVAAAPPARFVCLPVAELRREGEA
FVRTEYLPPSMTVPLTSPLGAMCGQITARLREKALRLADRLSAHSRSKERDVLEELRRQI
HALVTALPPFEVVLGTGRSHPYALYLALSSLVGHLAALARMPVPPVLPAYQHDDLRVTFS
TARDHVFRLVDEGILESFTAHPFDFGEGRYLVEFQRRFAGRPVLVAVRGRRGAQEKDVVS
WVEGALIGSARRAREMQQSRVLGAGRRRVDRHGDLIAPAGTVLFELEPSSPYLDLGEPLL
IFNTGDPSAAAGPAELVLYVKATDERA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgccccgcggaagtacccgccgccgtccagtggcacgacggtatgctgctctcg
ccgcagcacttccaggaggccgcgcggcgctccgagcgcctcctcgattaccacctcggg
cagctccacccgttccattacggggtccaccacctcgagatcgacgccgggctgctggcg
agcggcacgctgcgcgtcctcgaggtcgaggccgtgctccccgatcacctcgtcgtccat
cacaccgcgcgcgatcccgagctccaggtcgacctcaagccccatgccgccgagctcgcg
gcaggccccctcaccgcgtacctcgccgtgcccaaggagcacctcggcggcgccgccacc
ggcggcgatctcgcccgctatcgctcgatcgagggagcgccggtcccggacgacaacacg
ggagaagagccgctcccgatcccgcgcctcgtcccggtggcgcgcctgctcgtcgcggcc
gcgccgccggcccgcttcgtgtgcctgcccgtcgcggagctgcggcgcgaaggggaggcg
ttcgtgcgcaccgagtacctgccgccgagcatgaccgtccccctcacctcgccgctcggc
gcgatgtgcggccagatcaccgcgcggctgcgcgaaaaggcgctgcggctcgccgacagg
ctcagcgcgcattctcgcagcaaggagcgagacgtgctcgaggagctgcgccggcaaatc
cacgccctcgtcaccgccttgccccccttcgaggtcgtgctcggcacgggcagatctcac
ccctacgccctctacctcgcgctctcctccctcgttggccacctcgctgccctcgcccgc
atgccggtcccgcccgtcctgcccgcttaccagcacgacgatctgcgggtcaccttcagc
accgcgcgcgaccacgtctttcgcctcgtcgacgagggcatcctggagtcgttcacggcg
caccccttcgacttcggcgaggggcgctatctcgtggagttccagcggcgcttcgccggg
cggcccgtgctcgtcgccgtgcgcggccgccgcggggcgcaggaaaaggacgtcgtgagc
tgggtcgagggcgcgctcatcggctcggcgcgccgcgcgcgcgagatgcagcagagccgc
gtgctcggcgccggacggcggcgcgtcgatcgccacggggatctgatcgcgcccgcaggg
accgtgctcttcgagctcgagccgtcgagcccctacctcgatctcggcgagccgctcctc
atcttcaacacgggagatccctccgcggccgccgggcctgcagagctcgtcctgtacgtg
aaagcgaccgacgagcgagcatga

DBGET integrated database retrieval system