KEGG   Streptomyces clavuligerus: BB341_09620Help
Entry
BB341_09620       CDS       T04717                                 

Definition
(GenBank) betaine-aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00010  Glycolysis / Gluconeogenesis
sclf00053  Ascorbate and aldarate metabolism
sclf00071  Fatty acid degradation
sclf00280  Valine, leucine and isoleucine degradation
sclf00310  Lysine degradation
sclf00330  Arginine and proline metabolism
sclf00340  Histidine metabolism
sclf00380  Tryptophan metabolism
sclf00410  beta-Alanine metabolism
sclf00561  Glycerolipid metabolism
sclf00620  Pyruvate metabolism
sclf00625  Chloroalkane and chloroalkene degradation
sclf00903  Limonene and pinene degradation
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
sclf01120  Microbial metabolism in diverse environments
sclf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB341_09620
   00053 Ascorbate and aldarate metabolism
    BB341_09620
   00620 Pyruvate metabolism
    BB341_09620
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BB341_09620
   00561 Glycerolipid metabolism
    BB341_09620
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BB341_09620
   00310 Lysine degradation
    BB341_09620
   00330 Arginine and proline metabolism
    BB341_09620
   00340 Histidine metabolism
    BB341_09620
   00380 Tryptophan metabolism
    BB341_09620
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB341_09620
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BB341_09620
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BB341_09620
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BB341_09620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ANW21865
Position
2460772..2462223
Genome map
AA seq 483 aa AA seqDB search
MTNTAAGNPFTYAPAPESRAIVDIAPSYGLFIDGEFTESSGQEMVKTVSPATEEVLAEYT
QGTGEDVDRAVRAARKAFSTWSALPGAERAKYLFRIARIIQERSRELAVLETLDNGKPIR
ETRDADLPLVAAHFFYYAGWADKLGHAGFGPNPRPLGVAGQVIPWNFPLLMLAWKIAPAL
AAGNTVVLKPAETTPLSALFFADICRQAGLPKGVVNIVTGDGRTGEALVTHPGIDKVAFT
GSTAVGKAIARQVAGTGKRLTLELGGKGANIVFDDAPIDQAVEGIVTGIFFNQGQVCCAG
SRLLVQESIQDELLDALKRRLATLRLGDPLDKNTDIGAINSAEQLARITALARTGEAEGA
ERWSTPCELPSSGFWFPPTLFTGVTQAHTVARDEIFGPVLSVLSFRTPDEAVAKANNSQY
GLSAGIWTEKGSRILAVANKLRAGVVWANTFNKFDPTSPFGGYKESGFGREGGRHGLEAY
LDV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaccgccgcgggcaacccgttcacgtacgcgcccgcgcccgaatcccgcgcg
atcgtcgacatcgccccctcctacggcctcttcatcgacggggagttcaccgagtccagc
ggccaggagatggtcaagaccgtctcccccgccaccgaggaggtcctcgcggagtacacg
cagggcaccggggaggacgtggaccgcgcggtccgcgccgcccgcaaggcgttctcgacg
tggtccgcgctgcccggcgcggagcgcgcgaagtacctcttccggatcgcccggatcatc
caggagcgcagccgtgagctggccgtcctggagaccctggacaacggcaagccgatccgg
gagacccgggacgccgatctgcccctggtggccgcgcacttcttctactacgcgggctgg
gccgacaagctgggccacgcgggcttcggcccgaacccgcgcccgctgggcgtcgcgggc
caggtcatcccgtggaacttcccgctgctgatgctcgcctggaagatcgccccggcgctg
gccgccggtaacacggtggtgctgaagcccgccgagaccaccccgctctccgccctcttc
ttcgcggacatctgccgtcaggcggggctgcccaagggtgtcgtgaacatcgtcaccggc
gacggccgcaccggtgaggccctggtcacccacccgggcatcgacaaggtggccttcacc
ggctccacggcggtcggcaaggccatcgcccgccaggtcgccgggaccggcaagcggctc
accctggagctgggcggcaagggcgccaacatcgtcttcgacgacgccccgatcgaccag
gcggtcgaggggatcgtcaccggcatcttcttcaaccagggccaggtctgctgcgcgggc
tcccggctgctggtccaggagtcgatccaggacgagctgctggacgcgctcaagcgccgg
ctggccacgctgcggctgggcgacccgctggacaagaacaccgacatcggcgcgatcaac
tccgccgagcagctcgcccggatcaccgcgctcgcccgcacgggcgaggcggagggcgcc
gagcgctggtccaccccgtgcgagctgccctcctcgggcttctggttcccgccgaccctc
ttcaccggggtcacgcaggcccacaccgtcgcccgggacgagatcttcggcccggtgctg
tcggtgctgagcttccgcacccccgacgaggccgtggccaaggccaacaacagccagtac
ggactctccgcgggcatctggaccgagaagggctcccgcatcctcgccgtcgcgaacaag
ctccgcgcgggtgtcgtctgggccaatacgttcaacaagttcgacccgacctcgcccttc
ggcggctacaaggagtcgggcttcggccgcgagggcggtcgccacggcctggaggcttac
ctcgatgtctga

DBGET integrated database retrieval system