KEGG   Streptomyces clavuligerus: BB341_12890Help
Entry
BB341_12890       CDS       T04717                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00310  Lysine degradation
sclf01100  Metabolic pathways
sclf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    BB341_12890
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     BB341_12890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 NAD_binding_8 Pyr_redox_2 Amino_oxidase Mqo NAD_binding_7 Thi4 NAD_binding_9 Lycopene_cycl Pyr_redox Trp_halogenase Pyr_redox_3 AlaDh_PNT_C HI0933_like MCRA
Motif
Other DBs
NCBI-ProteinID: ANW19059
Position
3200728..3202257
Genome map
AA seq 509 aa AA seqDB search
MRSHGWWHGVVAQSTDSGTDTGGTAPSAGRSDGVVSGRVQYRGWEVARVTVVDGRAGDGE
EGTAEDTESTGEGTAGDATGDTAGDTAADTGGSSPGPADPGTGPWAPTGHRGGFDCDVLV
VGGGIVGLATAHALLRAAPGTRVTVLEKEATTAAHQTGRNSGVIHSGIYYRPGSLKARFA
VRGAAEMVGFCAENDLPHRVTGKLIVATSRDELPRLHALVQRGRENGIPVRELGPAQITE
YEPEVRGLAAIQVGTTGVCDFGAVAARLAVLVEKSGGRVDCGEEVTAVDRRAWGVAVRTA
TGRVLRARALVNCAGLHCDRVARLAGDDPEMRIVPFRGEYYELADPARVRGLVYPVPDPA
FPFLGVHLTRGIDGGVHVGPNAVPAGAREGYRRSTVRPRELAWTLAWPGTWQMAREHWRY
GAGELHRSLSKTAFTAAVRRLLPSVTEADLRPAPSGVRAQAVLRDGTLADDFLIKEAPRT
VHVLNAPSPAATASLPIGREVAARVLRLL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgcacgggtggtggcacggggtggtggcacagagcacggactcgggtacggac
acagggggtacagcaccttcggcgggcaggtcggacggtgttgtcagtggccgggtgcag
tatcgggggtgggaggtggcgcgggtgacggtggtcgacggcagagccggggacggggaa
gagggcacggcggaggacacggaaagcacgggggagggcacggcaggggacgcgacggga
gacacggcaggggatacggcggcggacacgggcggatcgtccccggggccggcggacccg
gggacggggccctgggcacccaccggccaccgcggtggcttcgactgcgacgtcctggtg
gtcggcggtgggatcgtcggcctggcgaccgcccacgccctcctccgcgccgctcccggc
acccgggtgaccgtcctggagaaggaggccaccacggccgcccaccagaccgggcggaac
agcggagtgatccacagcgggatctactaccgccccggctcgctcaaggcccggttcgcg
gtgcggggcgccgccgagatggtcgggttctgcgccgagaacgacctgccgcaccgggtc
accggcaagctcatcgtcgccacctcacgggacgagctgccccggctccacgccctcgtc
cagcgcggccgggagaacggcatcccggtgcgggagctgggcccggcgcagatcaccgag
tacgagccggaggtgcgcgggctcgcggccatccaggtggggacgaccggtgtgtgcgac
ttcggcgcggtggccgcccggctggcggtgctggtagagaagtccggcggcagggtcgac
tgcggcgaggaggtcacagccgtggaccgcagagcgtggggcgtcgcggtgcgcaccgcg
acggggcgggtcctgcgggccagggccctggtcaactgcgcggggctgcactgcgaccgg
gtggcccggctggcgggtgacgacccggagatgcggatcgtccccttccggggggagtac
tacgagctggcggaccccgcacgcgtccgggggctggtctatccggtgccggacccggcc
ttccccttcctcggcgtccatctgacccgcggcatcgacggcggtgtccacgtcggtccg
aacgcggtgcccgcgggcgcccgcgagggctatcggcggtcgacggtccggccccgggag
ctggcctggacgctggcctggcccggcacctggcagatggcccgggagcactggcggtac
ggggccggtgagctgcaccgttccctgtcgaagacggcgttcacggcggcggtgcgccga
ttgctgccctcagtcaccgaggccgatctgcgcccggccccgtccggggtgcgggcgcag
gcggtgctgcgggacggcaccctggcggacgacttcctgatcaaggaggccccccgtacg
gtccatgtgctgaacgcgccgtccccggcggcgacggcgtccctgccgatcgggcgggag
gtggcggcccgggtactgcggctgctctga

DBGET integrated database retrieval system