KEGG   Streptomyces clavuligerus: BB341_22370Help
Entry
BB341_22370       CDS       T04717                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00030  Pentose phosphate pathway
sclf00480  Glutathione metabolism
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
sclf01120  Microbial metabolism in diverse environments
sclf01130  Biosynthesis of antibiotics
sclf01200  Carbon metabolism
Module
sclf_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sclf_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BB341_22370
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BB341_22370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sclf04147]
    BB341_22370
Enzymes [BR:sclf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BB341_22370
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BB341_22370
Exosome [BR:sclf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BB341_22370
  Exosomal proteins of colorectal cancer cells
   BB341_22370
  Exosomal proteins of bladder cancer cells
   BB341_22370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ANW20757
Position
complement(5507436..5508965)
Genome map
AA seq 509 aa AA seqDB search
MSGIGEANPLRDTADRRLPRIAGPSGLVIFGVTGDLSRKKLMPAVYDLANRGLLPPGFSL
IGFARREWQDEDFAQEVHDAVKEHARTPFREEVWQQLNQGMRFVQGDFDDDEAFEHLKKT
IAELDQAQGTGGNFAFYLSVPPKFFPKVVQQLKKHGLAEKEGSWRRAVIEKPFGHDLESA
EELNQVVHEVFPSNEVFRIDHYLGKETVQNILALRFANTLFEPIWNRSYVDHVQITMAED
IGIGGRAGYYDGIGAARDVIQNHLLQLLALTAMEEPASFDADALAAEKVKVLGAVRLPKD
LGESTVRAQYAAGWQGGEKAVGYLQEDGIDPSSTTDTYAAIKLAIDNRRWAGVPFYLRTG
KRLGRRVTEIAVVFQRAPHSPFDHTATEELGQNALVIRVQPDEGVTLRFGSKVPGTSMEV
RDVSMDFAYGESFTESSPEAYERLILDVLLGDSNLFPRVEEVELSWKILDPIEEYWEQNG
RPAQYAAGTWGPVEADEMLARDGRSWRRP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggtattggcgaggccaatccgctgcgtgacaccgccgaccgacggctcccgcgt
atcgcggggccgtcgggcctggtcatcttcggtgtcacgggcgatctctcccgcaagaag
ctcatgcccgcggtctacgacctggccaaccgcgggctgctgccaccaggtttctcgctc
atcgggttcgcccgccgtgagtggcaggacgaggacttcgcgcaggaggtccacgacgcc
gtcaaggagcacgcccgcactcccttccgggaggaggtctggcagcagctcaaccagggg
atgcggttcgtccagggcgacttcgacgacgacgaggcgttcgagcacctgaagaagacc
atcgccgagctggaccaggcacagggcaccggcggcaacttcgccttctatctctcggtg
ccgccgaagttcttccccaaggtcgtccagcagctcaagaagcacggtctggccgagaag
gagggctcctggcgccgggcggtcatcgagaagccgttcgggcacgacctggagtcggcg
gaggagctgaaccaggtcgtccatgaggtcttcccctcgaacgaggtcttccggatcgac
cactacctgggcaaggagaccgtccagaacatcctggcgctgcggttcgcgaacacgctc
ttcgagccgatctggaaccggtcgtatgtcgaccatgtccagatcaccatggccgaggac
atcggcatcggcggccgggccgggtactacgacggcatcggcgccgcgcgggacgtcatc
cagaaccatctgctccagttgctggcgctgaccgcgatggaggagcccgcctcctttgac
gcggacgcgctcgcggcggagaaggtcaaggtgctgggcgcggtgcggctcccgaaggac
ctgggcgagtccaccgtgcgcgcccagtacgcggccgggtggcagggcggcgagaaggcc
gtcggctatctccaggaggacgggatcgacccctcgtccaccacggacacctatgccgcg
atcaagctggcgatcgacaaccgccgctgggcgggcgtgcccttctatctgcggacgggc
aagcggctcggccgccgggtcaccgagatcgcggtggtcttccagcgggccccgcactcc
ccgttcgaccacacggcgaccgaggaattggggcagaacgccctggtcatccgggtacag
ccggacgagggcgtgaccctgcgcttcggttccaaggtcccgggcacctcgatggaggtc
cgggacgtgtcgatggacttcgcctatggcgagtccttcacggagtccagcccggaggcg
tacgagcggctcatcctcgatgtgctgctcggcgactcgaacctcttcccccgggtggaa
gaggtggagctgtcctggaagatcctcgacccgatcgaggagtactgggagcagaacggc
aggcccgcgcagtacgcggcggggacctggggtccggtcgaggcggacgagatgctcgca
cgagacggacggagctggcggcggccatga

DBGET integrated database retrieval system