KEGG   Streptomyces clavuligerus: BB341_25315Help
Entry
BB341_25315       CDS       T04717                                 

Definition
(GenBank) polyprenyl synthetase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
sclf  Streptomyces clavuligerus
Pathway
sclf00900  Terpenoid backbone biosynthesis
sclf01100  Metabolic pathways
sclf01110  Biosynthesis of secondary metabolites
sclf01130  Biosynthesis of antibiotics
Module
sclf_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:sclf00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BB341_25315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sclf01006]
    BB341_25315
Enzymes [BR:sclf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BB341_25315
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BB341_25315
    2.5.1.29  geranylgeranyl diphosphate synthase
     BB341_25315
Prenyltransferases [BR:sclf01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BB341_25315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ANW21290
Position
complement(6189549..6190637)
Genome map
AA seq 362 aa AA seqDB search
MHETTVAAAGARERIAAHRRRFDPLFAAYFDRLAAAPGPFTAGRFPARCVELLRDQSLRG
GKRLRVALLHEAARLVTDAEVPGLDEAALSVELLHTHGLVHDDIVDDAPLRRGAPSVYYA
YRAEFPGQERTAVGLAVLAGDLAAFLSVQVLLEAPLPDGLRLALAQEQTRASAETVLGQF
LDLERDVPPLPGDDFLHTVTEFKSARYSILAPLRLGLLAAGEDPEPYAGELRRYAVLVGI
YEQMRDDYLDLFGDPAVTGKPVGTDLRDGRRTYAVNALLAGVDGADRKRVESALGDPGCD
DATIAEIGALARRAGVDERLRATMLRYAREASDEAAGWRPRWREEAVSFFSALPLWSVRR
TF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgagaccaccgtggccgccgccggagcacgggagcggatcgccgcccaccggcgg
cggttcgacccgctcttcgcggcgtacttcgaccggctcgccgccgcccccggcccgttc
acggcgggacggttccccgcgcgctgtgtggaactgctgcgggaccagtcgctgcgcggc
ggaaagcggctgcgggtcgccctgctccacgaggcggcccggctggtgaccgacgcggag
gtgccggggctcgacgaggcggcgctgagcgtcgaactgctgcacacccacggcctggtg
cacgacgacatcgtggacgacgcgccgctgcgccgcggcgccccgtcggtgtactacgcc
taccgggccgaattccccggccaggagcggacggcggtggggctcgccgtgctcgcgggg
gacctcgccgcctttctctccgtccaggtcctgctggaggcaccgctccccgacgggctg
cggctggccctggcgcaggagcagacgcgggcctcggccgagaccgtgctcggccagttc
ctcgatctggaacgggatgttccgccgctgccgggcgacgacttcctgcacaccgtcacg
gagttcaagtccgcgcgctactcgatcctcgcaccgctgcgtctcggactgctggccgcg
ggcgaggacccggagccgtacgcgggcgagctgcgccggtacgcggtcctcgtggggatc
tacgagcagatgcgggacgactatctcgacctcttcggcgacccggcggtcaccgggaag
cccgtgggcacggatctgcgcgacggccgtcgcacctatgccgtgaacgcgctgctggcc
ggggtcgacggggccgacagaaagcgggtggagtcggcgctcggcgaccccgggtgcgac
gacgccacgatcgcggagatcggcgccctggcccggcgcgcgggcgtcgacgaacggctg
cgcgcgaccatgctgcggtacgcgcgggaggcgtccgacgaggcggccggctggcggccc
cgatggcgggaggaggccgtctccttcttctccgccctgccgctgtggagcgtgcggcgc
accttctga

DBGET integrated database retrieval system