KEGG   Sphingobium cloacae: SCLO_1014770Help
Entry
SCLO_1014770      CDS       T05301                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
sclo  Sphingobium cloacae
Pathway
sclo00270  Cysteine and methionine metabolism
sclo00480  Glutathione metabolism
sclo01100  Metabolic pathways
Module
sclo_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:sclo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCLO_1014770
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SCLO_1014770
Enzymes [BR:sclo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     SCLO_1014770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: BAV64517
UniProt: A0A1E1F1X3
Position
SCLO_1:complement(1711179..1712153)
Genome map
AA seq 324 aa AA seqDB search
MTQLNPLTVAVQMDPMEGINIEGDSTFHIMLAARERGHRLYHYLAPDLTYREGRVLAKAR
PVRVQKVAGDHFIFGEPEMLDLGRDVDVVLMRQDPPFDLSYITATHLLERVQAETLVVND
PAAVRDAPEKLFVLDYARFMPPTMITRDLEEVRSFLARHGEIVVKPLYGNAGNAVFHVGQ
SGANLSALVELFKSSWVEPFMVQAFIPGVAKGDKRIVLVDGEVAGAVNRIPGAGEIRSNL
AVGGSAAKTQLTGKEEEICAALGPELKRRGLLFVGIDVIGGEWLTEINVTSPTGIVSIDA
FNGTDTGGMIWDAIDARLAARAAA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacccagttgaacccgctcaccgtcgccgtgcagatggacccgatggaagggatcaat
atcgaaggggactcgaccttccacatcatgctcgccgcgcgggagcggggacacaggctc
taccattatctcgcgcccgacctcacctatcgcgaaggccgcgtgctggcgaaggcgcgt
cccgtgcgcgtgcagaaggtcgcgggcgatcacttcatcttcggcgaaccggaaatgctg
gaccttggccgcgacgtggacgtggtgctgatgcggcaggacccgcccttcgacctttcc
tacatcaccgccacgcatctgctggaacgggtgcaggccgaaacgctggtggtgaacgat
cccgccgccgttcgcgatgcgccggaaaagctgttcgtgctcgactatgcgcgcttcatg
ccgcccaccatgattacccgcgacctggaggaggtgaggagcttcctcgcccggcatggc
gagatcgtggtgaagccgctctacggcaatgcgggcaacgccgtctttcatgtcgggcag
tcgggcgcgaatctgtcggcgctggtggaactgttcaaatcctcatgggtcgaacccttc
atggtccaggctttcatccccggcgtcgcgaagggcgacaagcgcatcgtcctggtcgat
ggcgaagtggcgggcgcggtcaaccgcattcccggcgcgggcgagatccgatccaatctc
gcggtcggcggatcggcggcgaagacgcagcttaccgggaaggaagaggaaatctgcgcc
gcgctcggcccggaactgaagcgccgggggctgctgttcgtaggcatcgacgtgatcggc
ggggaatggctgacggagatcaacgtgacatcgcccacgggcatcgtctccatcgacgcc
ttcaacggcaccgacacgggcggcatgatctgggacgcgatcgacgcgcgccttgccgcg
cgggcggcggcatga

DBGET integrated database retrieval system