KEGG   Sphingobium cloacae: SCLO_6000240Help
Entry
SCLO_6000240      CDS       T05301                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
sclo  Sphingobium cloacae
Pathway
sclo00072  Synthesis and degradation of ketone bodies
sclo00280  Valine, leucine and isoleucine degradation
sclo00650  Butanoate metabolism
sclo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sclo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCLO_6000240
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SCLO_6000240
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCLO_6000240
Enzymes [BR:sclo01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     SCLO_6000240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: BAV66973
UniProt: A0A1E1F8X4
Position
pSCLO_6:complement(26646..27323)
Genome map
AA seq 225 aa AA seqDB search
MMTQNTSGWSREQMAERAARELEDGYYVNLGIGIPTLVANYVPHDIEVTLQSENGMLGMG
PFPYADEVDPDLINAGKQTITQLPTSSFFSSADSFAMIRGGHIDLTVLGAMEVSASGDIA
NWTIPGKMVKGMGGAMDLVAGVKRVVVVMEHCNKHGAPKILEECSLPLTGQNVVDLIVTD
LCVLACDKVAGGLTLVELAPGITAEQVVSSTAAAVDISAFEAEAA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgcagaacacgagtggctggagccgtgaacagatggccgagcgcgctgcgcga
gagcttgaggatggttactacgtcaatctaggcatcggcatacccactctggtcgccaac
tatgtgccccatgacatcgaagtcaccttgcagtcggagaacggcatgttgggcatgggc
cccttcccttatgccgacgaagttgatccggacctcatcaatgccggcaaacagaccatc
acgcaattgcccacctccagcttcttttcctccgcagacagcttcgcgatgatccgggga
ggccatatcgatcttaccgttcttggcgccatggaagtctctgccagcggtgacatcgcc
aactggacgatcccgggcaagatggtgaagggaatgggaggcgcaatggacctggtcgcc
ggcgtcaagcgtgtggtcgtggtgatggagcactgcaacaagcacggtgctcccaagatc
ctggaggagtgctcgctgccgcttaccggccagaacgtagtggacctgatcgtcaccgac
ttgtgcgtgttggcctgcgacaaagtagcaggcggcctgacgctggtggaactggcgcca
ggcattaccgcggagcaggtcgtctccagcaccgcagcagccgtcgatatctcggccttt
gaagcggaggcggcctaa

DBGET integrated database retrieval system