KEGG   Schizophyllum commune: SCHCODRAFT_104477Help
Entry
SCHCODRAFT_104477 CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K06634  cyclin H
Organism
scm  Schizophyllum commune
Pathway
scm03022  Basal transcription factors
scm03420  Nucleotide excision repair
Module
scm_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SCHCODRAFT_104477
  Replication and repair
   03420 Nucleotide excision repair
    SCHCODRAFT_104477
Transcription machinery [BR:scm03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SCHCODRAFT_104477
DNA repair and recombination proteins [BR:scm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SCHCODRAFT_104477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N TFIIB Telomere_Sde2
Motif
Other DBs
NCBI-GeneID: 9594849
NCBI-ProteinID: XP_003038901
JGI: Schco1_104477
UniProt: D8PKL8
Position
Unknown
AA seq 355 aa AA seqDB search
MNPTHNSAQPTANGDPGPSSARGKPIYEGSTQFRNWRFSPERLAHTRARLNAGAVDAIRV
AFETDEPGSSSRVQFLTADEELLLVKLYASKIPQMCQLFRFPEEVEATAITYLKRFYLKN
TVMDWHPKNVMLTALFLATKTTNNPISIEHYTKVIPRVEVSDVLDIEFLVAQSLGFEFSV
WHAHRALWGIWLDLQTVPDAPPPDHNIYQKALSHVAQSRLTDAELIYTPSQIAHACLSLA
APNLAEQWLEAKFPSTSPEKAASATMLRDVIATLRALITTEGQAPPIEAVREVDRRLRLC
KNPEKIPGTKAYLARKAEEERKAEEKRQRKLKAATMGSDPFGETLVEEGLDDDDD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctacccacaatagcgcgcagcctacggcgaatggtgatccgggaccgtctagc
gcgcgcggaaagcccatatacgagggcagcacccaatttcgcaactggcgtttctccccc
gagcgtctcgcgcatacacgagcgcgtctgaatgcgggtgcggtggacgcgatacgcgtg
gcgttcgagacggacgagccaggctcatcgtctcgagtgcaattccttaccgcggacgag
gagctgctgctcgtcaagctttacgcgtccaagattccccaaatgtgccagctcttccga
tttccggaggaggtcgaagcgacggcgatcacctacttgaagcgcttctacctcaagaac
actgtgatggactggcatcccaagaacgtcatgctgaccgcactgttcctcgccacaaag
acgaccaacaaccccatttccatcgaacactacaccaaagtcattcctcgcgtcgaagtt
tccgacgtcctcgacatcgagttcctcgtggcgcaaagcctcggctttgagttctccgta
tggcacgcgcaccgcgcactgtggggtatctggctagacttgcagacggtaccggacgcg
cctcccccagaccacaacatctaccagaaagccctctctcatgtcgcacaatcccgcttg
accgacgcagagttgatatacacaccatcacaaatcgcgcacgcatgcctttccctcgca
gcacccaacctcgccgagcagtggttggaggccaagttcccctcgacctctccggagaaa
gctgcatctgctaccatgctacgtgatgtcatcgcaaccctccgggccctcatcacgact
gaggggcaagcaccgccgattgaggctgtccgggaggtagaccgtcgactacgactatgc
aaaaacccggagaagatacccggaacaaaggcctatctagcacggaaagcagaagaagaa
cggaaagcggaagaaaaacggcagcgaaagctcaaagcggcgaccatgggatcggaccct
ttcggcgagacattagtggaggaggggttagacgacgacgatgat

DBGET integrated database retrieval system