KEGG   Schizophyllum commune: SCHCODRAFT_13992Help
Entry
SCHCODRAFT_13992  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
scm  Schizophyllum commune
Pathway
scm00220  Arginine biosynthesis
scm00330  Arginine and proline metabolism
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01130  Biosynthesis of antibiotics
scm01230  Biosynthesis of amino acids
Module
scm_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SCHCODRAFT_13992
   00330 Arginine and proline metabolism
    SCHCODRAFT_13992
Enzymes [BR:scm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SCHCODRAFT_13992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 9587348
NCBI-ProteinID: XP_003034850
JGI: Schco1_13992
UniProt: D8PV15
Position
Unknown
AA seq 313 aa AA seqDB search
MSASQSRFIPNPKTAAIVGCPFMGGQGKPGVDKGPIHLVEAGLIDQLTELGWKVKFDGHH
QFESINAASDPPIGKLKNPRLVSRVCESVAKVVGEHVKAGELPVTLGGDHSLAMGTISGT
LSTHPDACVVWIDAHADINTPDTTDSGNIHGMPVSFLLGIGSKVPEFAWVKPLLKANRLV
YIGLRDVDAGEKKILKDNNIKAFSMHEVDKYGIGKVVEMALDHVNPSRDRPIHLSFDVDA
LDPTVTPSTGTPVRGGLTFREGHYICEAVYETGLLVALDIMEVNPSLADPEGVKATVAVG
CSLARAALGETLL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgtcccagtctcgcttcatcccgaaccccaagaccgcggccatcgtcggatgc
cccttcatgggcggccagggcaagcccggtgtggacaagggacccattcatctcgtcgaa
gcaggcctcatagatcagctcactgagttgggatggaaggtcaagttcgatggccaccac
cagtttgagagcatcaacgctgccagcgatccgcccatcggcaagctcaagaacccgcgt
cttgtgtcgcgtgtctgcgagtccgtggccaaggtcgtcggcgaacacgtcaaggcgggc
gagcttcccgtgactctcggaggcgaccacagcttggctatgggcaccatctcaggcact
ttgagcacccacccagatgcctgcgtcgtctggatagacgcccatgcagacatcaacacc
ccggacaccaccgactctggcaacatccacggcatgcccgtctccttcctcctcggcatc
ggcagcaaggtccccgaattcgcctgggtcaagcccctcctcaaagccaaccgcctcgtg
tacatcggcctccgcgacgtcgacgccggcgagaagaagatcctcaaggacaacaacatc
aaagccttctccatgcacgaggtcgacaagtacggcatcggcaaggtcgtcgagatggcg
ctcgaccacgtcaacccgagccgggatcggcctatccatttgagcttcgacgtggacgcg
ctggacccgactgtgacgccgtcgacgggtacgccggtgcgtggggggttgactttccgc
gaggggcactacatttgcgaggcggtttatgagactggcctgcttgtcgcgctggatatc
atggaggtgaacccgtctctcgcggaccccgagggtgtgaaggcgactgtcgccgttggg
tgctcgctcgcgcgtgctgcgcttggagagacgcttttgtag

DBGET integrated database retrieval system