KEGG   Schizophyllum commune: SCHCODRAFT_258667Help
Entry
SCHCODRAFT_258667 CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K14298  mRNA export factor
Organism
scm  Schizophyllum commune
Pathway
scm03013  RNA transport
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SCHCODRAFT_258667
Messenger RNA biogenesis [BR:scm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     SCHCODRAFT_258667
Chromosome and associated proteins [BR:scm03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    SCHCODRAFT_258667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Frtz WD40_like Nup160 LEM Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 9593607
NCBI-ProteinID: XP_003027117
JGI: Schco1_258667
UniProt: D8QID3
Position
Unknown
AA seq 349 aa AA seqDB search
MSFFSTPASSSSAEKDVEMPDPPSDSISSVAFSPQADYLAVGSWDNSVRIYEVGAGGQSQ
GKALYQHQGPVMGVCWNKEGNKVFSGGADNAGRMFDVATGQATQVAQHDMPIKAVRWIDA
PQAGILATASWDKTIKYWDLRSSTPVASVTCPERVYTFDVQFPLMVVGTAERHIQIFNLS
NPSTPYKSIQSPLKWQTRVVSCFTQSANSGFAVGSIEGRVAIQYVEEKDSANNFSFKCHR
RDSQPNSKDQSLVYAVNDISFHPVHGTFSTCGADGTIHFWDKDARTRLKSFDAQPGPITS
TAFNRTGTIFAYAVSYDWSKGHSGNTPGHPNKLMLHACKDEEVKKRPKK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcttctcgacgccggcgtcgtcctcctcggcggaaaaggatgttgagatgccc
gacccgccctcggattctatctcctccgtcgcgttctccccgcaagcggactatcttgca
gtcggtagctgggacaatagcgtgcgcatctatgaagtcggcgcgggcgggcagtcgcag
gggaaggcgctctaccagcaccagggacccgtgatgggcgtgtgctggaacaaggagggg
aacaaggtgttctcgggcggcgcggacaacgcggggcgcatgttcgacgtggcgacgggg
caggcgacgcaggtcgcgcagcacgacatgccgatcaaggccgtgcggtggatagacgcg
ccgcaggcggggatcctcgcgacggcgagctgggacaagacgatcaagtactgggacttg
cggtcgtcgacgccggtggcgagtgtgacgtgcccggagagggtgtacacgtttgatgtg
cagttcccgctcatggtcgtcggtacggcggagcgccacatccagatattcaaccttagc
aatcccagcacgccgtataagtcgatacaatccccgttgaagtggcaaacacgcgtcgtg
tcgtgcttcacacagtctgcaaacagtggcttcgcggtaggcagcatcgaaggacgcgtc
gccatccaatacgtcgaagaaaaggactctgccaacaacttctccttcaaatgccaccgc
agagacagccaacccaactccaaggaccagtcgctcgtctacgccgtcaacgacatctcc
ttccacccagtgcatggaaccttctcgacatgcggcgccgacgggaccatccacttctgg
gataaagatgcacgcacgcgcctgaaatcgttcgatgcccagccgggtccgatcacgagt
acagcgttcaaccggacggggacgatcttcgcgtacgcggtgtcctacgactggtcgaag
ggccactcggggaacacgcccgggcacccgaacaagctcatgctgcacgcgtgcaaagac
gaggaggtcaagaagaggcccaagaagtag

DBGET integrated database retrieval system