KEGG   Schizophyllum commune: SCHCODRAFT_46389Help
Entry
SCHCODRAFT_46389  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
scm  Schizophyllum commune
Pathway
scm00600  Sphingolipid metabolism
scm01100  Metabolic pathways
Module
scm_M00094  Ceramide biosynthesis
scm_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SCHCODRAFT_46389
Enzymes [BR:scm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     SCHCODRAFT_46389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1 OTOS
Motif
Other DBs
NCBI-GeneID: 9585926
NCBI-ProteinID: XP_003037916
JGI: Schco1_46389
UniProt: D8PPY2
Position
Unknown
AA seq 306 aa AA seqDB search
PFLFVQHRVPGSPDSDPRYQKGVLDFVLIAYYIVFWSLCRILIAGRLFTRIGRFYGLKKE
GKLDRVGEQGYAIVYYTASGLWGLRIMSQLPIWWYRTEEFWLGYPHWDMIPELKQFYLMQ
SAHWLHELMIMVLGFEKPRKDFAELVAHHAVTLWLVGWSYLINLTHIGISVFVSMDIPDV
LLALSKLLNYLQFPRAKVAVFVVFFGVWSYFRHWLNLVILHSVWTEFDLIPEIHRRWAPP
TGAWLTWWMKYQIFAPILLLQILNLFWYYLMWRILIRAIRTAGEASDVRSDDEDDGEEEE
EGAKEK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
cccttcctcttcgtgcaacatcgcgtgcccggctcgccagacagtgatccgcgctaccag
aagggtgtcctcgacttcgtgctcatagcatactacatcgtgttctggtcgctatgccgc
atcctcatcgcggggcgtctcttcacgcgtatcgggcgcttctacggcctcaagaaggag
ggcaagctcgaccgcgtcggtgagcaggggtatgcgatagtgtactacactgcgtctggt
ctctggggcttgaggattatgtcgcaactccctatctggtggtaccgcacggaagagttt
tggctcggctacccgcactgggacatgatacctgagctcaagcagttctacctcatgcag
tctgcgcactggcttcatgaacttatgatcatggtcctcggctttgagaagccccgcaaa
gactttgccgagctcgttgcgcatcatgcggtcaccctctggcttgtcggatggagctac
ttgatcaaccttacccacattggtatctcggtcttcgttagcatggatattccggatgtt
cttctggctctttccaaattgctgaactacctgcaattcccgcgtgccaaggtcgccgtc
ttcgttgtcttcttcggcgtatggagttacttccgccactggctgaacctggtcatcctc
cactccgtctggaccgagtttgacctcattcccgaaatccaccgccgctgggcacccccg
accggcgcctggctcacttggtggatgaagtaccagatcttcgcgcccatcctcctcctc
cagatcctcaacctgttctggtactacctgatgtggcgcatcctgattcgcgccatccgt
acggccggtgaggcgagcgatgtgcggtcggacgatgaggatgatggggaagaggaggag
gagggggcgaaggagaagtag

DBGET integrated database retrieval system