KEGG   Schizophyllum commune: SCHCODRAFT_46575Help
Entry
SCHCODRAFT_46575  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
scm  Schizophyllum commune
Brite
KEGG Orthology (KO) [BR:scm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:scm03041]
    SCHCODRAFT_46575
   03009 Ribosome biogenesis [BR:scm03009]
    SCHCODRAFT_46575
Enzymes [BR:scm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SCHCODRAFT_46575
Spliceosome [BR:scm03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    SCHCODRAFT_46575
Ribosome biogenesis [BR:scm03009]
 Eukaryotic type
  90S particles
   Helicases
    SCHCODRAFT_46575
  Pre-60S particles
    SCHCODRAFT_46575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII AAA_22
Motif
Other DBs
NCBI-GeneID: 9589717
NCBI-ProteinID: XP_003038464
UniProt: D8PN65
Position
Unknown
AA seq 528 aa AA seqDB search
MAAEGSSQPEERVPFSTLELSEPTMRGLTDMGFSTMTPVQAKSIPVLLAGKDVLGAARTG
SGKTLAFLIPAIEMLHRLKFKPMNGTGIIIITPTRELALQIFGVAKDLMAHHSQTYGIVM
GGANRRAEMEKLQKGVNLLIATPGRLLDHLQNSKGFVFRNLKALVIDEADRILEVGFEEE
MKRIISILPNENRQSMLFSATQTTKVQDLARISLRPGPVSIDVDKEEATSTVSTLSQGYV
VCPSDRRFLLLFTFLKKHLKKKIIVFFSSCNSVKYHAELLNYIDTPVLDLHGKQKQQKRT
NTFFEFINAESGILLCTDVAARGLDIPRVDWIIQYDPPDDPRDYIHRVGRTARAGKVGKS
LLFLLPSELGFLRFLKESKVPLNEYSFPANKIANVQSQLEKLLQKNYFLHQSAKDGYRSY
LQAYASYSLKKIFDVNALDLAKVGKAFGFTVPPRVNVNIGEGKGNATKKRKRAEGEEFEP
ELEPVETSSWRQSKERRVETLGRKKVEKEVYKKNKERQKMGANGQWSR
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgaaggctcctcccaacccgaggagcgggttcccttctccaccctcgaactc
tccgagcccactatgaggggcctcaccgacatgggcttctcgacgatgaccccggtgcag
gccaagtccatccccgtgctcctggccggcaaggacgtgctgggcgcggcgcgcacgggg
tcggggaagacgcttgccttcctcatcccggcgattgagatgctgcaccgactgaagttc
aagccgatgaatgggacggggatcattatcatcacgccgacgagagagttggcgctgcag
atctttggcgtggcgaaggacttgatggcgcaccattcgcagacgtatggaatcgtgatg
gggggcgcgaaccggagagcagagatggagaagttgcagaagggcgtgaatctacttatt
gcgactcctggaaggcttctcgatcatcttcagaatagcaagggcttcgttttccgcaac
ctgaaggcgcttgtgatcgacgaggctgaccggatattggaggttggcttcgaggaggag
atgaagaggattatctccatacttcccaatgaaaatcgccaatccatgctcttctccgcc
acccagaccaccaaagtccaggacctcgcacgaatatccctccgccccggccccgtctcc
atagacgtcgacaaggaggaggctaccagcactgtctccaccttgtcccagggctacgtc
gtctgcccctccgaccgccgcttcctccttctcttcaccttcctcaaaaagcacctcaag
aagaagatcatcgttttcttctccagctgcaattctgtcaaataccacgcggagctgctg
aattatattgacacgccggttctggacttgcatggcaagcaaaagcagcagaagcgcaca
aataccttcttcgagttcatcaacgccgagtctgggatcctgctctgcactgacgtcgcc
gcccgtgggctcgacatcccgcgagtagactggatcatccagtacgacccgccagatgac
cctcgcgattacatccaccgtgtcggccgtactgcgcgtgcagggaaggtcggcaagagt
ctgctgttcttgctacccagcgagcttgggtttctgcgcttcctgaaggagtcgaaggtg
ccgttgaatgagtatagcttccctgcgaacaagattgcgaatgtgcagagccagctcgag
aagttgctgcagaagaactacttcttgcaccagtccgcaaaggacggctaccggtcatac
ttgcaggcgtacgcctcatattcgctcaagaagatcttcgacgtcaatgcgcttgatctg
gccaaggtcgggaaggcgttcggcttcacggtgccaccacgggtgaacgtgaacatcggg
gagggcaaggggaacgcgacgaagaagcggaaacgtgcagagggtgaagagtttgagcca
gaactcgagccagtggagacgagcagctggagacagtcgaaggagcgcagggttgagacg
ttgggcaggaagaaggtggagaaggaggtgtacaagaagaacaaggagaggcaaaagatg
ggcgctaatggtcagtggagtagatga

DBGET integrated database retrieval system