KEGG   Schizophyllum commune: SCHCODRAFT_52972Help
Entry
SCHCODRAFT_52972  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
scm  Schizophyllum commune
Pathway
scm00770  Pantothenate and CoA biosynthesis
scm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCHCODRAFT_52972
Enzymes [BR:scm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SCHCODRAFT_52972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 9586036
NCBI-ProteinID: XP_003034687
UniProt: D8PY43
Position
Unknown
AA seq 215 aa AA seqDB search
MSKQHPSKRPFIAQNERTEGFTHVLLITTGSVASVKALLIVKQLLQYDCVKVEVVATKPS
LAFYSPEEIERTGSRVWTDEDEWTDDYSIGDPILHIELRRWADVVLVAPCSANTLSKIAH
GACDNLVTSLLRALAPSTPTYIFPAMNTLMYEHPLTAEHLRIVREVVGYEVVGPIGKKLA
CGDVGMGAMTEWMEIVKLVVDRFGLVLKGPATSQS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcaacacccttccaagcgccctttcattgcacaaaacgaacgcacagaaggc
ttcacgcacgtattactcatcaccacaggcagcgtcgcctctgtgaaggcgctcttgatc
gtgaaacagctcttgcagtacgactgcgtgaaagtcgaagtcgtggccacaaagccctcc
ctcgccttctattccccagaagagatagaaagaacaggaagccgcgtatggacagacgaa
gacgagtggacggatgactactccatcggcgaccctatattgcacatcgagctacgtcgg
tgggcggatgtagtcctcgtcgcgccttgctcggcgaatacgctgtcgaagatagcgcac
ggcgcctgcgataacctcgtcacctctctcctccgcgccctcgcgcccagcacgccaacc
tacatattccccgctatgaacacgctgatgtacgagcaccccctgacggcggagcacctc
cgtatcgtgcgcgaggtagtcggctacgaggtagtcgggcccattggaaagaagttggcg
tgcggggatgtgggaatgggcgcgatgacagagtggatggaaattgtcaaacttgtcgtg
gaccgttttgggctcgtgctgaaggggcctgcgacttcgcagtcgtga

DBGET integrated database retrieval system