KEGG   Schizophyllum commune: SCHCODRAFT_64850Help
Entry
SCHCODRAFT_64850  CDS       T01331                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
Organism
scm  Schizophyllum commune
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-GeneID: 9585094
NCBI-ProteinID: XP_003037462
JGI: Schco1_64850
UniProt: D8PRX8
Position
Unknown
AA seq 532 aa AA seqDB search
MATLKGLFLGALLSGLGYAQTNEPVSGDYSGALRPQIHFSPPTDFMNDPNGCFVDANGTW
HLYYQYNPTDLVAGNQHWGHATSKDLYHWENQPIAIYPPDNTSQVFSGSAVIDVNNNSGF
FPNQTDGVVAIYTLNTPDGQVQEISYSRDGGYTFTTYEGNPVININSTQFRDPKVIRYED
SWVAVIAYSQEFVVGIFTSPDLIHWTHASNFSHHGLLGLQYECPNLVKIPVDGSDEEMYL
LTISLNPGAPLGGSVTEYFPGTFNGTHFTPVDGAARLADFGKDNYAGQFFYGVPEDEHPV
SIAWASNWQYTGNVPTGKEGWRSAMTVPRRHYLTQAPRIGWDLVQVPADLSPVLGAQLGS
NDALANASLTVDFADVKSNAVVLEVNVTGSAFDNSWVKFAFRSASSGEALLGGCLFGGVD
ITCYVDRGKTLGFEDPFFTDKISLGQIIKPSGEWTATVIFDRSIIEVLLDGGLYSGTQTF
FPTEPLTILEVNSSSMPETAQVAARVTALKSGWDDEAAEGKTQENVAVNDEL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttgaaggggcttttccttggtgctcttctcagtggcctgggctatgcgcag
acgaacgagcccgtttcgggagattactccggggcgttgaggcctcagatccatttttcg
ccgccgacggacttcatgaacgatcccaacggctgttttgttgacgctaatggcacctgg
cacctttactaccaatataatccgactgacttggtggcgggaaaccagcactggggccac
gctacgagcaaggacctctatcattgggagaaccaacccatcgccatctatccgccggac
aacaccagccaggtcttcagtggctccgccgtcatcgacgtgaacaacaactccggcttc
ttccccaaccaaaccgacggcgtcgtagccatttacactctcaacacgcccgatggtcaa
gtccaggagatctcgtactcacgcgacggcggctacaccttcacgacctacgagggcaac
cccgtcatcaacatcaactcgacgcagtttcgcgaccccaaagtcattcgctacgaggac
tcgtgggtcgcggtcatcgcgtactcgcaggagttcgtcgtcggcatctttacctcgccg
gacctcatccactggacgcacgcgtcgaacttctcgcaccatgggctgctcggtctgcag
tacgagtgcccgaaccttgtcaagatccccgtcgacggctcggacgaggagatgtacctc
ctgacaataagcctcaacccgggcgcgccgctcggcgggagcgtgacggagtacttcccg
ggcacattcaacggcacgcacttcacgcccgttgacggcgcggcgcggctggcggacttc
gggaaggacaactacgccgggcagttcttctatggcgttcccgaggacgagcacccggtc
tcgatcgcgtgggcgagcaactggcagtacacgggcaacgtaccgacggggaaggagggc
tggcgcagcgccatgacggtcccgaggcggcactacctgacgcaggcgccgcgcatcggc
tgggacttggtccaggtccccgctgacctctcgcccgtcctcggcgctcagctcggctcg
aacgacgcgctggcgaatgcgagcctgacggtcgacttcgccgacgtgaagagcaacgcg
gtggtgctcgaggtcaacgtgacgggctcggcgttcgacaacagctgggtgaagttcgcc
ttccgctcggcctcatccggcgaagcgctgctcggcggttgcctcttcggcggcgtcgac
atcacctgctacgtcgaccgcgggaagacgctcggatttgaggaccccttcttcaccgac
aaaatttcgctggggcagatcatcaagccttccggggagtggaccgcgaccgtcatcttc
gacaggagtatcattgaggtcctgctcgatggtggcctttacagcgggacgcagacgttc
ttcccgaccgagcctctgacgatcctcgaggtcaactcgagcagcatgccggagactgca
caggtggccgctcgtgtcacggcgttgaagagtggttgggacgacgaagcggcagagggg
aaaacgcaggagaatgtagcagtgaacgatgaattgtag

DBGET integrated database retrieval system