KEGG   Schizophyllum commune: SCHCODRAFT_70858
Entry
SCHCODRAFT_70858  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
scm  Schizophyllum commune
Pathway
scm00100  Steroid biosynthesis
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    SCHCODRAFT_70858
Enzymes [BR:scm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     SCHCODRAFT_70858
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 9593644
NCBI-ProteinID: XP_003027154
UniProt: D8QIL6
Position
Unknown
AA seq 447 aa
MSKTPAQDVAVRTQDNASLNPRTTKYEFAGPLGALFVTVTVPIFSYLLYFGCSEQSGGCF
LENTARCTVVALAKRDLTDPEWWKGLWDREAAIAYAAWYAFCVVCWAVVPGEWVQGVRMR
NGETKSYKINALPTAMLTLGLTFGYIFQNGPEKFTFIYHHWVGLVTASLIWSTVLALYVY
AMSFKKGKLLAEGGNSGNPIYDFFIGRELNPSIGSFDIKSFNELRPGLILWMLIDISMVC
EQAVRRGGFDKVTDSMWLVLAFHCWYVMDSLYNEPAIFTTMDITTDGFGFMLSVGDLVWV
PFTYSLQARYLAFRHVELGPFWTAFIVGVNLLGYYIFRSANGQKNDFRNGKENNLKYFET
STGRKLITSGWWGWSRHPNYFGDWLMAVAWSLPTGFATPFTYFYPIYFAILLVHRQLRDD
EACHKKYGADWDTYKKLVPWRIVRYIY
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtccaagacgccagcccaggacgtcgccgtccggacccaggacaacgccagcctgaac
ccgcgcaccaccaagtacgagttcgctggccccctcggcgcgctcttcgtcaccgtcacc
gtccccatcttctcctacctgctctactttggctgctccgaacagagcggggggtgcttc
ctcgagaacaccgcgcgctgcacggtcgtcgcgctggcgaagcgggacctgacggacccg
gagtggtggaaggggctgtgggatcgggaggcggcgattgcgtacgcggcgtggtatgcg
ttctgcgtggtgtgctgggcggtggtgccgggggagtgggtgcagggcgtgaggatgcgc
aatggggagacgaagagctataagatcaatgcgctgccgactgcgatgctcactctgggc
ttgaccttcggctacatattccagaacggccctgagaagttcacgtttatctaccaccac
tgggtcggcctcgtcaccgcgtccctcatctggtccactgttctcgcgctctacgtctac
gccatgtcgtttaagaagggcaagctcctcgccgaggggggaaactctggcaaccccatc
tacgacttctttatcggtcgcgagctgaacccatcaatcggctccttcgacatcaagtcc
ttcaatgaattgcgccctggcctcatcctgtggatgctcatcgacatcagcatggtctgc
gagcaggcagttcgtcgcggtggcttcgacaaggtcaccgactcgatgtggctagtcctc
gccttccattgctggtacgtgatggactcgctctataacgagccggctatcttcaccacc
atggatatcacgaccgacggcttcggcttcatgctttctgttggtgacctagtatgggtg
ccgttcacatacagtcttcaggcgaggtaccttgctttcagacatgtcgagctcgggcct
ttctggaccgccttcattgtgggcgtgaacctgctcggttactacatcttccgttccgcc
aacgggcaaaagaacgatttcaggaatggcaaagagaacaacctgaagtacttcgagacc
tccaccggacgcaaactgatcacctcgggttggtggggttggtcgcggcacccgaattat
ttcggagactggctcatggccgtcgcctggtcgcttccaaccggcttcgccacacccttc
acatacttctaccccatctattttgcaattctgctcgtgcaccgccagttgcgcgatgat
gaggcgtgccacaaaaagtatggcgcggactgggatacctacaagaagcttgtgccgtgg
aggattgtgagatacatctattag

DBGET integrated database retrieval system