KEGG   Schizophyllum commune: SCHCODRAFT_78485Help
Entry
SCHCODRAFT_78485  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
scm  Schizophyllum commune
Pathway
scm00010  Glycolysis / Gluconeogenesis
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCHCODRAFT_78485
Enzymes [BR:scm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     SCHCODRAFT_78485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 9590190
NCBI-ProteinID: XP_003028860
UniProt: D8QD99
Position
Unknown
AA seq 597 aa AA seqDB search
MSEQTVANTRAQMDRLQLEVSELKGQKGVEDITVGDYLLARLDQLQVTNMFGLPGDFNLG
FLDLVEDHPNIHWVGNCNELNASYAADGYARVKPGSMGVLLTTFGVGELSAVNGIAGSYA
EMVPILHIVGAPSTSQQLSKPLLHHTLGDARYEAYARAYEQFTCCQKYLMNKETAAAEID
HLLTEILVKARPGYMTLPTNLVFEKISSERLRTPLSGLPPPNDPEVEAHVIEEIVAKVKA
ANGGVAVLVDACAVRHDVVAELKELIEKTHLPVYSTPMGKTVIPENYDRYGGIYIGSISR
PEIREKLEAASLVLSIGGLRSDYNSGNFTYNFPVSHTIELHSDHTKIAYAQYPAIGMKQL
IPKLTAKLEAFAAAQQAIAVPKFNAVFPKEDTEIISQAWFWPTMSEFFKPHDVIIAETGT
ASFGITNVPFPPESVFIAQIFWGSIGYSVGSTLGAALAARDRKLGRTILFVGDGSLQLTV
QELSTMLRMELKPIVFVLNNNGYTIERWLHGKERKYNDIFPWAWADLLKVLGDKEEKRST
SYTVNNKKELSALLADETFLRADKMQLVEVMMDQFDAPITLVNQAELSGKTNAYVPK
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcagaccgtcgccaacacccgggcccagatggaccgccttcagctcgaggtc
agcgagctcaagggccagaagggcgtcgaggacatcaccgtcggcgactacctgctcgcg
cgtctcgaccagctccaggtgacgaacatgttcggtcttcctggagacttcaacctcggc
ttcctcgatcttgtcgaggaccaccccaacatccactgggttggtaactgcaacgagctt
aacgcttcgtacgccgccgacggctacgctcgcgtcaagcccggctccatgggtgtcctg
ctcacgaccttcggtgtcggtgagctctccgccgtcaacggcattgccggctcctatgcc
gagatggtccccatcctccacatcgtcggtgccccgtccacgtcgcagcagctctcgaag
cccctcctccaccacacgctcggtgatgcgcgctacgaggcctacgcccgtgcctacgag
cagttcacctgctgccagaagtacctcatgaacaaggagaccgccgccgccgagatcgac
cacctcctcaccgagatcctcgtcaaggcccgccccggctacatgaccctccccaccaac
ctcgtcttcgaaaagatctcctccgagcgcctccgcactcccctctctggcctgccgccc
ccgaacgacccggaggttgaggcccacgtcatcgaggagatcgtcgccaaggtgaaggcc
gccaacggcggtgtcgccgttctcgtcgatgcctgcgctgtccgccacgacgtcgttgcc
gagctcaaggagctcatcgagaagacccaccttccggtttactcgacgcccatgggcaag
accgtgatccccgagaactacgaccgctacggtggtatctacatcggctcgatctcgcgc
cctgagatccgcgagaagctcgaggccgcgagcctcgtcctctccatcggtggcctccgc
tccgactacaactccggcaacttcacctacaacttccccgtctcccacaccatcgagctc
cactccgaccacaccaagatcgcctacgcgcagtacccggccatcggcatgaagcagctc
atccccaagctgactgccaagctcgaggctttcgcggcggcacagcaggcgatcgctgtc
cccaagttcaacgccgtcttccccaaggaggacacggagatcatctcccaggcctggttc
tggccgacaatgagcgagttcttcaagccgcacgatgtcatcatcgccgagactggtact
gccagcttcggtatcaccaacgtccccttcccgccagagtccgtcttcatcgcccagatc
ttctggggctccatcggctactccgtcggctctacgctcggcgctgccctcgccgcgcgc
gaccgcaagctcggccgtactatcctcttcgtcggtgacggttctctgcaactcaccgtc
caggagctctcgaccatgctccgcatggagttgaagccgatcgtcttcgtccttaacaac
aacggctacaccatcgagcgctggctgcacggcaaggagcgcaagtacaacgacatcttc
ccctgggcatgggccgacctcctcaaggtcctcggtgacaaggaggagaagcgctcgaca
tcgtacaccgtcaacaacaagaaggagctctccgcccttctcgccgacgagaccttcttg
cgcgcagacaagatgcagctcgtcgaggtgatgatggaccagttcgacgccccgatcacg
ctcgtcaaccaggctgagctctcgggcaagacgaacgcgtacgtgccaaagtaa

DBGET integrated database retrieval system