KEGG   Schizophyllum commune: SCHCODRAFT_78726Help
Entry
SCHCODRAFT_78726  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
scm  Schizophyllum commune
Pathway
scm03013  RNA transport
Module
scm_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:scm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SCHCODRAFT_78726
Messenger RNA biogenesis [BR:scm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     SCHCODRAFT_78726
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     SCHCODRAFT_78726
Translation factors [BR:scm03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SCHCODRAFT_78726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 9590594
NCBI-ProteinID: XP_003028719
JGI: Schco1_78726
UniProt: D8QEA3
Position
Unknown
AA seq 282 aa AA seqDB search
MMEDPKTPGIQVKKPEHPLQYTWTIYHDTKSSKFPPTPAPPASAASDTTSFHQTESTDYE
AGLTVVGSFATVEEFCRYFNWLKPPSHLERNSNYHLFKSGIKPMWEDPANANGGKWVLTM
KNNPQLLDRCWNWLVMALVGEELEEGHDEICGAVVSLRAKVDRIQVWTRGKEDVERLNGI
GKKLVKLLDISEADGIGLEFQFNTEDRPQPNKFLSIQAMPQSGFRNSFHGPPGSGAPFHH
PPRQDTASPVGGPQSAVNPNASAFGGFGVGMGGPGWRVPKRG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatggaggatccgaagacgccgggcatccaggtgaagaagcccgagcaccccctgcag
tacacctggacaatataccacgacacaaagtcctccaagttcccgcccacccccgcgccg
cccgccagcgccgcgtccgacaccacctccttccaccagaccgagtcgacggactacgag
gccgggctcaccgtcgtcggcagcttcgcgaccgtcgaggagttctgccggtacttcaac
tggctcaagccgccctcgcacctcgagcgcaactcgaactaccacctcttcaagtccggc
atcaagccgatgtgggaggaccccgcgaacgcgaacggcggcaagtgggtgctcacgatg
aagaacaacccgcagctgctcgaccgctgctggaactggctcgtcatggccctcgtcggc
gaggagctcgaggaggggcacgacgagatctgcggcgcggtcgtcagcctgcgcgcgaag
gtcgaccgcatccaggtctggacgcgcgggaaggaggacgtcgagcggctgaacggcatc
gggaagaagctcgtcaagctgctcgacatctccgaggcggacggcatcgggctcgagttc
cagttcaacacggaggacaggccgcagccgaacaagttcctgtcgatccaggcgatgccg
cagtccggcttccgcaactcgttccatgggcccccgggcagcggcgcccccttccaccac
cctccgcggcaggatacagcctcgccagtcggtgggccgcaatccgccgtcaaccccaac
gcgagcgcgttcggcggattcggcgtgggcatgggcgggcccggctggcgcgtaccgaag
cgcgggtag

DBGET integrated database retrieval system