KEGG   Schizophyllum commune: SCHCODRAFT_81979Help
Entry
SCHCODRAFT_81979  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
scm  Schizophyllum commune
Pathway
scm00061  Fatty acid biosynthesis
scm00254  Aflatoxin biosynthesis
scm00620  Pyruvate metabolism
scm00640  Propanoate metabolism
scm01100  Metabolic pathways
scm01110  Biosynthesis of secondary metabolites
scm01130  Biosynthesis of antibiotics
scm01212  Fatty acid metabolism
Module
scm_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:scm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCHCODRAFT_81979
   00640 Propanoate metabolism
    SCHCODRAFT_81979
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SCHCODRAFT_81979
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    SCHCODRAFT_81979
Enzymes [BR:scm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     SCHCODRAFT_81979
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SCHCODRAFT_81979
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SCHCODRAFT_81979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter ATP-grasp_3 Dala_Dala_lig_C ATP-grasp
Motif
Other DBs
NCBI-GeneID: 9590685
NCBI-ProteinID: XP_003032695
JGI: Schco1_81979
UniProt: D8Q0Q3
Position
Unknown
AA seq 2228 aa AA seqDB search
MSAYDHSRDAFSGGNSIDKAGAGSVADFVKSHGGHTVITKVLIANNGIAAVKEIRSVRQW
CYETFGREREIEFTVMATPEDLKINAEYIRMADNYIEVPGGTNNNNYANVDLIVDIAERA
GVHAVWAGWGHASENPRLPESLAASKNKIVFIGPPGSAMRSLGDKISSTIVAQHAQVPTM
PWSGSGIADTEMSAGGFVTVPDKAYKDACVTNVEEGLQRAEQIGYPVMIKASEGGGGKGI
RKVEHPDAFKNAFHAVAGEIPGSPIFIMKLAGQARHLEVQLLADQYGNAISLFGRDCSVQ
RRHQKIIEEAPVTIAKEETFEQMERAAVRLAKLVGYVSAGTVEYLYSPSEDYFYFLELNP
RLQVEHPTTEMVSGVNLPAAQLQVAMGIPLHRIRDIRQLYGVAPTAASEIDFDMINPDST
ATQRKPRPKGHVVAVRITAENPDAGFKPSSGSLQELNFRSSTNVWGYFSVSTAGGLHEFA
DSQFGHIFAYGEDREESRKNMIVALKEISIRGDFRTTVEYQVKLLELDAFKNNTITTGWL
DSLISSKLTAERPDPTLAVICGAVTKAHLASEACWTEYKRVLEKGQVPAKDTLKTVFSID
FIYENVRYSFTVTRSSRNAWTLYLNGGRTMVGARPLADGGLLVALDARSHSVYWREEVGA
LRLMVDAKTCLIEQENDPTQLRSPSPGKLIRYFVDSGDHIGAGQPYAEIEVMKMYMPLVA
SEDGVVQLIKQPGVSLEPGDILGILTLDDPARVKHAKPFEGLLPATGPPGVIGNKPYQRF
LRCIGILNDILDGFDNQAIMASTLKDLIDVLHDPDLPFSEMSAILSSLSGRIPAKLEDSI
RATLEAAKAKNDGHEFPSARLKKLVEHYAQDSVLPQDRAMFRASLAGIYDVLDRFAGGLK
GHELETIAGLLSRYVDTEKLFGGSIEARILALREKYKDDLDQVASLALSHIKAQSKGKLV
LALLDYVKTSGLNISTADNHLYEACQNLAALEAKSSTAVSLKAREVLIMGQMPSYEERHS
QMESILKHAVTNQFYGEQETASRTPSAEVLKELSDSRYTVYDVLPAFFNHKDPMVTLAAL
EVYVRRAYRAYTLLSIDYEEGDNLDDGDNPNVLTWRFNIGQSHSPPSTPRLTESRRTASV
SDLSYLVNRHQSQPVRTGAIASFPNLPTLKRGFKHVASLLPVFDTEEYRERYGKVQPPNV
LNLALRIFEREDDMPEDEWATQIAEFVNANKDELDYRGVRRVSVLICRKGQYPVYFTMRD
IDGVWKEEQAIRNIEPALAFQLELRRLSNYNLKPWFVEAKQIHIYHAVARENQLDQRFFV
RALVRPGRLRGSMSTAEYLISETDRLVTSILDALEVVSAQHRAADCNHIFINFVYNLAVT
YDDVLEAVAGFIERHGKRLWRLHVTGSEIRIALEDDEGNITPIRCVIENVAGFVVNFHGY
QEITTDKGTTILKSIGEKGPLHLQPVHQAYPTKESLQPKRYQAHLIGTTYVYDFPQLFAK
ALNNVWLEARKVDPSLTIPKNVLESRELVLDEHDQIAEVDRAPGNNTFGMVGWVYTLRTP
EYPSGRRVVVIANDITYKIGSFGPVEDQFFYQVSQYARDQGLPRIYLSANSGARIGLAEE
IFPLFSVAWNDDAHPEKGIDYLYLTRENFLKVQEKSPGAVRTIEVQAGDQRRHKITDIIG
LQDGIGVESLRGSGLIAGETSRAYDDIFTITLVTGRSVGIGAYLVRLGERAVQVEGQPII
LTGAQALNKVLGREVYTSNLQLGGTQIMFKNGVSHLTASSDLQAAQHIMQWLSYIPEFKL
APLPIRVNGDTWDRDISYTPPKGPYDPRWFIEGKRDESTEEWLPGIFDRGSFQETLSGWA
QTVVVGRARLGGIPMGVIAVETRTMERIVPADPANPSSFEQRIMEAGQVWYPNSAYKTAQ
AIFDFNREGLPLIIFANWRGFSGGQQDMYDEILKQGSKIVDGLSAYKQPVFVYIVPNGEL
RGGAWVVLDPSINSEQMEMYADVDARAGILEPEGIIEIKMRRDKILSLMERLDPTYAALK
KDSKDPSKSPEEQAAAASQLEARESDLAPTYKQLALLYADLHDRTGRMEAKGCAKPTQWK
NARRHFYWATRARVARSAALAQLAEASPGSSFEYRSGLLDTLAGIDATTPHRTAAEKLEA
LDISGTLVKLQADHLMRRLVQLTREDRKASLDSMMRLADNLSDDERQSLIDALQGAGRSP
GPPSYTAP
NT seq 6687 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgtacgatcactccagggacgcgttttcaggaggcaactccattgacaaggcc
ggcgcaggcagcgtcgcggactttgtcaagtctcatggcggccatacggtcataacgaag
gtcctcatcgcgaacaatggtattgccgcggtcaaggagattcgatctgtgcgccaatgg
tgctacgagaccttcggccgcgagcgcgagatcgagttcacggtcatggctacaccagag
gacctgaagatcaacgcagagtacattcgcatggccgacaactacatcgaggtccccgga
ggcaccaacaacaataactatgcgaacgtcgatctcatcgttgacattgctgagcgtgct
ggcgtccacgccgtctgggcaggctggggccacgcgtcggaaaaccctcgcctcccggaa
agcctcgcggccagcaagaacaagatcgtcttcataggtcctccgggctctgccatgcgt
agcttgggcgacaagatttccagtaccatcgtcgctcagcacgcgcaggtccccaccatg
ccatggtccggcagcggcatagccgacacggagatgtccgccggcggcttcgtcactgtc
cccgacaaagcgtacaaggacgcgtgcgtgacgaacgtcgaggagggcctgcagagggcg
gagcagatcggctaccccgtcatgattaaggctagcgagggcggcggcggcaagggtatt
cgcaaggtcgagcacccggacgcgttcaagaatgcgttccacgccgtcgccggcgagatc
cctgggtcacccatcttcatcatgaagctcgcggggcaggcgcgccacctcgaggtgcag
ctgctggcagaccaatacggtaacgcgatttcgctatttgggcgtgattgctccgtgcag
cggcgtcaccagaagatcattgaggaggcgcctgtcacgattgcgaaggaggaaaccttc
gagcaaatggagcgcgctgcggtgcgtctcgcgaagctcgttggatatgtcagcgctggg
acggtcgagtacctctacagcccatcggaagactacttctacttcctcgagttgaacccg
cgtctgcaggtcgagcacccgacaaccgagatggtgtcaggcgtgaacctccctgcagcg
cagctccaggtggccatgggaatcccccttcaccgcattcgcgacattcgccagctctat
ggcgtcgcaccaaccgcggcctccgagatagacttcgacatgatcaaccctgactcgacc
gccacgcagcgcaagccgcgtcccaagggccacgtcgtcgccgtccgcatcaccgccgag
aaccctgacgcaggcttcaagccctcgtctgggtccctgcaggaactcaacttccgctcg
agcacgaacgtctggggctacttctccgtcagcaccgcgggcggtctgcacgagttcgcg
gactcgcagttcgggcacatcttcgcgtacggcgaggaccgcgaggagagtcggaagaac
atgatcgtcgcgctcaaggagatcagcatccgcggtgacttccgcaccaccgtcgagtat
caggtcaagcttctcgagctcgacgcgttcaagaacaacacgatcacgaccggttggctc
gactcgctcatcagcagcaagctgaccgccgagcgccccgacccgacgctcgctgtcatc
tgcggcgctgtcaccaaggcgcatctcgcgtccgaggcgtgctggacggagtacaagcgc
gtgctagagaagggccaggtccccgcgaaggacacgctcaagacggtgttcagcatcgac
ttcatctacgagaacgtgcgatactcgttcaccgtcacgcgctcttcccgaaatgcatgg
acgctctacctcaatggtggccggacgatggttggtgcgcgcccgctggcggatggcggc
ttgctagtagcgcttgacgctcgcagtcactcggtgtactggcgcgaggaggttggcgcg
ctgcgtctgatggtcgacgcgaagacgtgcttgatcgagcaggagaacgacccgacgcag
cttcgcagcccgagtccgggtaagctcatccggtacttcgtcgacagtggcgaccatatc
ggtgcgggccaaccgtacgcggagattgaggtcatgaagatgtacatgcctctcgtcgcg
tcagaagacggtgtcgtccagctcatcaagcagcccggtgtcagccttgagcccggcgac
attctcggtatactcaccctggacgaccccgcccgcgtcaagcacgccaaacccttcgag
ggcctgctccccgccactggccctccgggcgtcatcggcaacaagccctaccagcgcttc
ctccgctgcatcggcatcctgaacgacatccttgatggcttcgacaaccaggccatcatg
gcgtcgacgctcaaggacctcatcgatgtcctgcacgatcctgacctccccttctcggag
atgagcgcgatcttgtcttctctctcaggccgtatcccggcaaagctcgaggacagcatc
cgtgcgacgcttgaggcggcgaaggcgaagaacgatgggcacgaattcccctctgcgcgc
ctcaagaagctcgtcgagcactacgcgcaggacagcgtgctcccgcaagaccgtgcgatg
ttccgcgcgtcgctcgcgggcatctacgacgtcctcgaccgcttcgcaggtggcctgaag
gggcacgagctggagacgattgcgggcctgctcagccgctacgtcgacaccgagaagctg
ttcggtggcagcatcgaggcgcgcattcttgccttgcgcgagaagtacaaggacgacctt
gaccaggttgcgtcgctcgcgctcagccacatcaaggcgcagagcaagggcaaacttgtg
ctggcgctgctcgactacgtcaagacgagcgggctgaacatctcgaccgcggacaaccac
ttgtacgaggcgtgccagaatctggctgctttggaggcgaagtcgtcaaccgctgtgtcg
ttgaaggcgcgcgaggtcctcatcatgggccagatgccttcgtacgaggagcgtcatagt
cagatggagagcatcctcaagcatgcagtcaccaatcagttctacggcgagcaggagacg
gcatcaagaacgccatcggccgaggtgttgaaggagcttagcgattcgaggtataccgtt
tacgatgtgttgccggcgttcttcaatcacaaggacccgatggtgacgttggctgctctc
gaggtctacgtgcgtcgcgcctaccgcgcgtacacgttgttgtccatcgactacgaggag
ggcgacaacctcgacgatggcgacaaccccaatgtccttacgtggcgcttcaacatcggg
cagtcgcactccccgccctcgacgccgagactcaccgaaagccgtcgtaccgcatccgtt
agcgacttgtcgtacctcgtgaaccgtcatcagtcgcagcccgtccgcaccggtgccatc
gcatcgttccccaacctccccacactgaagcgcgggttcaagcatgtcgcctcgctgctg
cccgtcttcgacaccgaggagtaccgcgagcgctacggcaaggtgcagccccccaacgtc
ttgaacttggccctgcgcatctttgagcgggaagacgatatgccggaggatgagtgggct
acgcaaatcgccgaattcgtgaacgccaacaaggacgagctggactaccgtggcgtgcgt
cgcgtctccgtgctcatctgccgtaagggccagtaccctgtgtacttcaccatgcgcgac
atcgatggcgtgtggaaggaggagcaggctatccgcaacattgagcccgctctcgccttc
cagctagagctcaggcggctgtccaactacaacctcaagccgtggttcgtcgaggcaaag
cagatccacatctaccacgccgtcgcccgcgagaaccagctcgaccagcgcttcttcgtg
cgtgcgctcgtccgccctggccgcctgcgcggcagcatgagcaccgcagagtatctcatc
tcagagacggatcgccttgtcacgagcattctcgacgcgctcgaggttgtcagcgctcag
caccgcgccgctgactgcaaccatatcttcattaacttcgtctacaacctcgcggtcacg
tacgacgacgtgttggaggccgtcgctggcttcatcgagcgtcacggcaagcgtctgtgg
cgcctgcatgtcacaggttccgagatccgcatcgcgctcgaggacgatgagggcaacatc
acccccatccgctgtgtcattgagaacgtcgccggcttcgtcgtcaacttccacggctac
caggagatcacgacggacaagggcacgaccatcttgaagtccatcggcgagaagggcccg
cttcacttgcagcctgtgcaccaagcgtacccgacgaaggagtccttgcagccgaagcgt
taccaggctcacctcatcggcaccacatacgtgtacgacttcccgcagctcttcgccaaa
gccttgaacaacgtctggctcgaggcccgcaaggtcgacccttcgcttactatccccaag
aatgtactcgagtcgcgcgagctcgtgcttgatgagcatgaccagattgccgaggtcgac
cgcgcgccgggaaacaacaccttcggcatggtcggctgggtgtacacgttgaggacgcca
gagtatccgagcggacggagggtggtcgtcatcgccaacgacatcacgtacaagattggc
tccttcggccccgtcgaggaccagttcttctaccaggtcagccagtacgcccgcgaccaa
ggcctcccgcgcatctacctatctgcaaactctggcgcgcgtatcggtcttgccgaggag
atcttccctctgttctcggttgcctggaacgacgacgcgcacccggagaagggtatcgac
tacctctacctcacgcgcgagaacttcttgaaggtgcaggagaagagccctggggctgtt
cgtaccatcgaggtgcaggccggtgatcagcgccgtcacaagatcacggacatcatcggt
ctgcaagacggtatcggtgtagagtctctgcgcggctccggtctcattgcaggcgagact
tcgcgcgcttacgatgatatcttcaccatcaccctcgtcactggtcgctcagtcggtatc
ggtgcttaccttgtccgccttggcgagcgtgccgttcaggtcgagggccagcctatcatc
ctcaccggtgcccaggcactcaacaaggtccttggccgtgaggtctacacgtcgaacttg
cagctcggcggcacgcagatcatgttcaagaacggcgtgtcgcacttgacggcgagcagc
gacctgcaggccgcgcagcacatcatgcagtggttgtcttacatccccgagttcaagctg
gcgcctctcccgattcgtgtcaacggcgacacatgggaccgcgacatctcgtacacgccg
ccgaagggcccctacgacccgcgctggttcatcgagggcaagcgcgacgagagcaccgag
gagtggcttccaggcatcttcgaccgcggctccttccaagagaccctcagtggctgggcg
cagactgtcgtcgtcggccgcgctcgccttggcggtatccccatgggtgtcatcgccgtt
gagacgcgcacgatggagcgcatcgtccccgccgaccccgctaacccgtcatccttcgag
cagcgcatcatggaggccggccaggtttggtaccccaactccgcctacaagaccgcgcag
gccatcttcgatttcaaccgcgagggtctcccgctcatcatcttcgccaactggcgtggc
ttctccggtggccagcaggacatgtacgacgagatcctcaagcagggctccaagattgtc
gacggcctctccgcgtacaagcagcccgtgttcgtgtacatcgtgccgaacggcgagttg
cgcggtggcgcttgggtcgtgctggacccgtcgatcaactcggagcagatggagatgtac
gcggacgtcgacgcgcgcgctggtatcctcgagcccgagggtatcatcgaaatcaagatg
cgccgtgacaagatcctctccctgatggagcgtctcgacccgacatacgcggcattgaag
aaggacagcaaggacccgtcgaagagccccgaggagcaagccgctgccgcttcgcagctc
gaggcgcgcgagtctgatcttgcaccgacctacaagcagctcgctctcttgtacgccgat
cttcatgatcgcaccggtcgcatggaggcaaagggttgcgcaaagcccacacaatggaag
aatgcccgccgccacttctactgggcaacccgcgcccgcgtcgctcgctctgccgccctc
gcccaactcgccgaagccagcccgggctcctccttcgagtaccgctccggcctcctcgac
accctcgccggcatcgacgccaccacgccacaccgcaccgccgccgagaagctcgaggcg
ctcgacatcagcggcacgctcgtcaagctgcaggccgaccacctcatgcgccggctcgtg
cagctcacgcgcgaggaccggaaggcgtcgctcgacagcatgatgcgcctcgcggacaac
ctctcggacgacgagcgccagtcactgatcgatgcgctgcagggcgcgggccgctcgcct
gggcctccctcgtacaccgccccctaa

DBGET integrated database retrieval system