KEGG   Schizophyllum commune: SCHCODRAFT_82121Help
Entry
SCHCODRAFT_82121  CDS       T01331                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
scm  Schizophyllum commune
Pathway
scm03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:scm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SCHCODRAFT_82121
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:scm03041]
    SCHCODRAFT_82121
Enzymes [BR:scm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SCHCODRAFT_82121
Spliceosome [BR:scm03041]
 Complex C
  Other components
   Step II factors
    SCHCODRAFT_82121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 T2SSE AAA_30 ABC_tran AAA_19 DUF2075
Motif
Other DBs
NCBI-GeneID: 9592887
NCBI-ProteinID: XP_003033520
UniProt: D8Q242
Position
Unknown
AA seq 1147 aa AA seqDB search
MADDLYNLEYLSLVAKITQEISNHTGLSDKTLAEFVIALHDQANQSLPAFKTKLQEMGAD
FPDSFIENVDRLILSMHPKHKKRPEKTNNGMNVDKPAELPEEEKKRRLFPGLAIQDKNPP
PAVADDVFLAELGDLVSGKKAPRTRPAEDDYDGRETKRQRRSPSPRRGRSPPRGYNRGRR
PPRLDDRPVVFKIYDGKVTGVKDFGAFVQLEGIAGRAEGMVHVSNIQKGVRINSAADLLS
RNQPVKVKVMAVAGSRITLSMKDDLTPELRIKSEAEMEEDRKRAYSAASSGANALPLNSR
DDPMPPPTRSAKRLTSPERWEIKQLIASGALPASDYPDIDDDFGSGAARAEVEEELDIEI
KEEEPPFLAGQTKRTLDLSPVKIVKAPDGSLNRAALAGASLAKERRELRQQEANEAADSQ
ARDFSTSWLDPMAKEGDRQFAQDLRGNLKGQKASEAPRWKEQTFNKATTFGEITSLSIQD
QRRSLPIYKLRDPLLKAIDEHQVLIVVGDTGSGKTTQMVQYLAEAGYADKGRIGCTQPRR
VAAMSVAKRVAEEVGCRLGQEVGYTIRFEDCTSPETRIKYMTDGMLQRECLIDPLCSQYS
VIMLDEAHERTIATDVLFGLLKKAVKRRPDLKLIVTSATLDAEKFSKYFFGCPIFTIPGR
TYPVEVLYTKEPESDYLDASLITVMQIHLSEPRGDILLFLTGQEEIDTACEILFERMKAL
GPKVPELLILPIYSALPSEVQSRVFEPTPEGSRKVVIATNVAETSLTIPGIYYVIDPGFS
KQNAYDPRLGMDSLVVMPISQAQARQRAGRAGRTGPGKCYRLYTEAAFRNEMLPNSIPDI
QRTNLSTTILQLKAMGINDLLSFDFMDPPPAQTMLTALESLYALSALDDEGLLTRLGRKM
ADFPMEPPLAKMLIASVELGCSEEILSIVAMLSVQSVFYRPKDKQGQADAKKAKFHQAEG
DHLTLLTVYNGWKAANFSNPWCYENFIQARSMRRAQDVRKQLLGIMDRYKHDVLSAGRDY
NRVRRAICSGYFRNTAKKDPQEGYKTLVEGTPVYIHPSSALFNRAPEWLIYHELVLTTRE
YCHNVTAIEPKWLVEVAPQFFKVADANKISKRKKQEKIEPLYNKYEKPDEWRLSKIKRSA
RSSQTFG
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgacctatacaacctcgaatacctgtcactcgttgcgaagatcacccaggaa
atcagcaatcacactggcctcagcgacaaaaccctcgccgagttcgtcattgcccttcat
gaccaagccaaccaatccctccccgcgttcaagacgaagctgcaggagatgggggccgac
ttccccgactccttcatcgagaatgtcgaccgtctgatcctcagcatgcacccgaagcac
aaaaagcgaccggagaagacgaacaatggcatgaatgtggacaagcctgcagagctgcca
gaggaggagaagaagaggcggctgttccctgggctcgcgatacaagacaagaacccgccg
ccagcggtggcagacgacgtcttcctggccgagctcggtgatctggtgtcggggaagaag
gcgccgcgcacgcgtccagcggaggacgactatgacggccgggaaacgaagcgccagcgc
cggagcccgagtcctcgacgcggacgcagccccccgcgcggctacaatcgcggtcgtcga
ccgccacgactggacgaccggcctgtggtcttcaagatttacgacggcaaagtgacgggt
gtcaaggatttcggggcattcgtgcagcttgagggcatcgccggacgagcagaaggtatg
gtgcacgtctccaatatccagaagggagtgcgcatcaattcggctgctgacctgctgagc
aggaatcagcctgtcaaggttaaggtcatggccgtcgctggctcgcgcatcaccctttcc
atgaaggacgacctcacacccgagctgcgcatcaagtccgaggcggagatggaggaggac
cgcaagcgtgcttactccgctgcgtcctcaggcgccaacgccctccccctcaactcgcgc
gacgatcccatgccccctccaacccgttctgcgaaacgtctgacgtcgccggagcgctgg
gagatcaagcagcttatcgcgtctggtgctctgcctgcgagtgactacccggatatcgac
gacgacttcggcagcggtgcggctcgcgcggaggtcgaggaggagcttgatattgagatc
aaagaagaggaaccgccattccttgctggccagacgaagcgcaccctcgacctcagtccg
gtgaagatcgtcaaggctccggacggctccctcaatcgcgctgctctggcaggtgcatca
ctcgccaaggagcggcgcgagcttcgtcagcaggaggcgaatgaggcagcggactcacaa
gcccgtgacttcagcacttcctggctggacccgatggcgaaggagggtgacaggcagttt
gcgcaggacttgcgcggaaacttgaaggggcagaaggcgagcgaggcgccgcgttggaag
gagcagactttcaacaaggcgacaactttcggagagattacatcgctcagcatccaggac
caacgacggtctctgcccatctacaagttgcgcgacccgttgttgaaagccatcgacgag
caccaagtactcatcgtcgtcggcgataccggttccggcaagactacacagatggttcag
tacctcgccgaggcaggctacgcggacaagggcagaataggctgcactcagcctcgtcgt
gtcgccgccatgtcggtcgccaagcgtgtcgcggaggaggtcggctgtcgtctcgggcag
gaagtcgggtacacgatccgtttcgaggactgcacaagtccggagacgcgcatcaagtac
atgacggatggtatgctgcagcgagagtgtctgattgatcctctgtgctcgcaatactca
gtcatcatgcttgacgaggctcacgaacggaccattgcaacggacgttctgttcggactg
ctaaagaaggctgtcaagcgcagaccagacctcaagctcatcgtcacctccgctactttg
gatgctgagaagttctccaagtacttcttcggatgcccgatcttcaccatcccgggtcgc
acataccccgtcgaggtcctctacacgaaggagccggagtcagactacctcgacgcgtcg
ctcattacggtcatgcaaatccacttgtctgagccgcgcggcgacatcctcctcttcctc
accggtcaagaagagatcgacacggcttgcgagatcctcttcgagcgcatgaaggccttg
ggtccgaaggtgcccgagctcctcatcctacctatctactccgccctaccgtccgaggtc
cagtctcgcgtcttcgagcctacgccagagggatctcggaaggtcgtcattgccaccaac
gtcgccgagacgagtctgacgatccccggtatctactacgttatcgacccgggcttctcg
aagcagaacgcgtacgacccgcggctgggtatggactcgctcgtggtcatgcccatctcg
caggcgcaggcgcggcagcgggcgggtcgtgcagggcggacaggaccgggcaagtgctat
cgcttgtacacggaggcggcgttcagaaacgagatgctgccaaactcaatcccggatatc
cagcggacgaacctgtcgacgacgatcttgcagctaaaggcgatgggcatcaacgacctg
ctcagcttcgacttcatggacccgccaccagcgcagacgatgttgacggcgttggagtcg
ttgtacgcattgtccgcgctcgacgacgaggggctgttgacgcggttggggcgcaagatg
gcggacttccctatggagccaccgttggcgaagatgctcatcgcgtcggtcgagcttggg
tgttcggaggagattctgtccatcgtcgcgatgctgtctgtgcagagcgtcttttaccgc
ccgaaggacaagcagggccaggcagacgcgaagaaggccaagttccatcaggcagagggc
gaccacctcacgctgctcaccgtctacaacggctggaaggcggcgaacttctcgaacccc
tggtgctacgagaactttatccaggcgcggagcatgcggcgcgctcaggacgtgcgcaag
cagctgctcggcatcatggaccgctacaagcacgacgtcctgagcgcagggcgcgactac
aaccgcgtccggcgcgcgatctgctccggctacttccggaacaccgcgaagaaggacccg
caggagggctacaagacgctcgtcgagggcacgcccgtgtacatccacccgtcctccgcg
ctgttcaaccgcgcacccgagtggctgatctaccacgagctggtgctcacaacgcgggag
tactgccacaatgtgacggcgatcgagcccaagtggctggtggaggtcgcgccgcagttc
ttcaaggtggcggacgcgaacaagatcagtaagcggaagaagcaggagaagatcgagccg
ctgtacaacaagtacgagaagccggacgagtggcggttgtcgaagatcaagcggagtgcg
cgttcgtcgcagacctttggctag

DBGET integrated database retrieval system