KEGG   Solitalea canadensis: Solca_0319Help
Entry
Solca_0319        CDS       T02084                                 

Definition
(GenBank) N-acetyl-beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
scn  Solitalea canadensis
Pathway
scn00511  Other glycan degradation
scn00520  Amino sugar and nucleotide sugar metabolism
scn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Solca_0319
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Solca_0319
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:scn03110]
    Solca_0319
Enzymes [BR:scn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Solca_0319
Chaperones and folding catalysts [BR:scn03110]
 Intramolecular chaperones
  Others
   Solca_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: AFD05462
UniProt: H8KXP7
Position
403561..405231
Genome map
AA seq 556 aa AA seqDB search
MKLKPLFIYFLLTITTLSSVFAQQSKTNDRYPIIPKPQNLIPRKGEFVINAQTQIVLNND
DEQLKTAVGFFTDLIEPSTGFKLGYTSNKDKNVIVFTLDPGMKNEEEYRIAVSSKIIDVR
SKTAAGAFRAIQTLRQLLPAAVEQKQVTSAVKWSIPAVVISDNPRFDYRGLHLDVCRHFF
PTEFIKKYIDLLALFKFNTFHWHLTEDQGWRIEIKKYPKLTTVGQWRPETAVGRTTTDTP
IMDRKYDGQPYQGFYTQDEIREVVKYAQDRFITIIPEIEMPGHALAALTAYPELGCTKGP
YEVAKHWGVFNDVFCVQDTTFTFLQNVLTEVIDLFPGKYIHIGGDECPKVRWEHCAHCQA
FMKENNIKDEHALQSYFIQRIEKFLNAKGRQIIGWDEILEGGLAPNATVMSWRGIEGGIA
AAKEKHDVIMTPSPYCYFDHYQADREKEPLAIGGFTTVEKIYGYEPVPEALTREEAKYIK
GAQANLWSEYIGTTEHVEYMVFPRALALAEVNWTKKESKNYNDFVERFQKQAKRLDVLNV
NYAKHILKTTSTTTAK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaaaccactctttatttattttctactaacgatcactacgctgtcgtcagtt
tttgctcaacaatcaaaaactaatgatcgctatccgattattccaaaaccgcagaatctt
attcctcgaaaaggtgaatttgtgatcaatgcacaaacccagatcgttctaaataatgac
gatgagcaactgaaaacggcggttggattctttacagaccttattgaaccatctaccggt
tttaagttaggttatacatcaaataaagacaagaatgtgattgtatttacgcttgatccg
ggaatgaaaaatgaagaagagtacagaattgctgtatcttcaaaaattattgatgtaaga
tcgaaaacggcagcaggtgcttttagggcaatccaaacgctaagacagttattgccagct
gctgttgaacaaaaacaggtgacttcagccgttaagtggagtatacctgcggttgttata
tcagataatccacgttttgattatcgcggattgcatttggatgtttgccgccatttcttt
ccaacagagttcattaagaaatatattgatctattggcattgtttaagtttaatactttc
cattggcatttaactgaagatcagggttggagaatcgagattaaaaaatatcctaaactg
acaactgttggacaatggcgccctgaaacagctgttggtcgtaccaccactgatactccg
ataatggatcgtaaatatgacggacaaccttatcagggtttttatactcaggatgagatt
cgtgaagtggtaaaatatgcacaagacagatttattacgattattcctgaaattgaaatg
ccaggccatgcattggcagcattaactgcatatcctgaattgggatgtactaaaggacct
tatgaagtagccaaacattggggagtatttaacgatgtattttgtgtgcaggataccaca
tttacattcttacaaaatgtactgactgaagttattgatctgttcccaggtaaatacatc
catattggcggtgatgaatgtcctaaagttcggtgggagcattgtgcacattgtcaggcc
ttcatgaaagaaaataacattaaagatgagcatgcattgcaaagctatttcattcaacga
attgagaaattcctcaacgctaaaggtcgtcagataattggttgggatgagattctggag
ggtggtttagctccaaatgcaacagttatgtcatggagaggaatagaaggaggcattgca
gcggctaaagaaaaacatgatgtgatcatgacacctagtccatattgttatttcgatcat
tatcaggctgatcgtgaaaaagagcctcttgctattggcggctttacaacagttgagaaa
atttacggatatgagcctgttcctgaagcattgacacgtgaagaagccaaatacattaaa
ggtgcacaagcaaacctttggtcagaatatattggaactacagaacatgttgaatatatg
gtgtttcctcgtgcattggctttagctgaggttaactggactaagaaggaaagtaaaaat
tacaacgacttcgttgagcgttttcagaaacaagcaaaacgattagatgtgcttaatgtg
aattatgcaaagcatatactaaaaacgacaagcacaacaacggccaagtaa

DBGET integrated database retrieval system