KEGG   Solitalea canadensis: Solca_2061Help
Entry
Solca_2061        CDS       T02084                                 

Definition
(GenBank) PLP-dependent enzyme, glutamate decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
scn  Solitalea canadensis
Pathway
scn00340  Histidine metabolism
scn01100  Metabolic pathways
scn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Solca_2061
Enzymes [BR:scn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     Solca_2061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Aminotran_1_2 Beta_elim_lyase zf-RING_9 Na_Pi_cotrans
Motif
Other DBs
NCBI-ProteinID: AFD07116
UniProt: H8KQX0
Position
2429045..2430211
Genome map
AA seq 388 aa AA seqDB search
MNYNLKEDDHNRLHDYMQKAEERAKHFIGYPIARDFDYSELYPLLSLPLNNVGDPLVDST
YDLNSRSLEQEVLAFFAELFNAPENNWWGYVTNGGSEGNLYGLYVARELFPNGIVYYSEA
THYSVQKNIQLLNLRSIVIRTQENGEMDYEDLRQMLQMHRDQPVIMLANIGTTMTEAKDD
LGEIQKILRDLAIKNHYIHCDAALAGTYSALLKMKPGFDFTYGADSIAISGHKFIGSPIP
CGLVLVKKNYKERIGRSVPYIGTVDTTITGSRNGHSPIFLWYAIKKLGKEGLKHRALTCL
ALAGYAIDQLQAIGVKAWRNPDALTIVFPKPSIKLRNRWQIATENEWSHIICMPGITKYQ
IDEFVAELAADIEEQKSLALAQRELQEV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaactataacttaaaggaagatgatcataaccgcttgcatgactacatgcaaaaggct
gaagaacgtgctaagcacttcattggatatccgatagcccgtgattttgactattctgag
ttgtatccattattaagcttaccattaaacaatgtgggcgatccgttggtagattctact
tacgatcttaactcacgttcattggagcaagaagttttggctttttttgcagaactgttt
aatgctcccgaaaataactggtggggatatgttaccaatggtggttcagaaggtaattta
tatggactatacgtagcccgtgaattatttccgaatggtatcgtttattattctgaagct
acgcattacagcgttcaaaaaaatatccaattactaaatcttcgcagtattgtaatccgt
acccaggaaaacggggaaatggattatgaagatcttcgacagatgttgcaaatgcaccgc
gatcagcctgtaattatgctggctaacatcggtactacaatgactgaagcaaaagatgat
ctgggtgaaattcagaaaatcttaagagatttggccattaaaaaccattatatccattgt
gatgctgctttagccggaacttacagtgccttgttaaagatgaaacctggatttgatttc
acttatggtgcagacagtatagctatcagcggacataaatttattggttctcctattcct
tgtggtttagttctggtaaagaaaaactataaagaacgtatcggaagatcagttccctat
atcggcactgtcgacacaacaatcacaggaagccgaaacggacatagcccgatctttttg
tggtatgcaattaaaaaattagggaaagaaggattaaaacatcgtgcgttaacatgcctt
gcattagcgggttatgctattgaccagttacaggcaattggtgtaaaggcatggagaaat
ccggatgcactgaccattgtattccctaagccttctattaaattacgcaatcgctggcaa
attgccactgaaaatgagtggagccacattatctgtatgccaggcattaccaaatatcag
attgacgagtttgtagcagaacttgcggctgatatagaagaacaaaaaagcctggcactt
gcgcaacgtgagttgcaggaggtttga

DBGET integrated database retrieval system