KEGG   Solitalea canadensis: Solca_3278Help
Entry
Solca_3278        CDS       T02084                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
scn  Solitalea canadensis
Pathway
scn00020  Citrate cycle (TCA cycle)
scn00620  Pyruvate metabolism
scn01100  Metabolic pathways
scn01120  Microbial metabolism in diverse environments
scn01200  Carbon metabolism
scn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Solca_3278
   00620 Pyruvate metabolism
    Solca_3278
Enzymes [BR:scn01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Solca_3278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_4 RimK Biotin_lipoyl_2 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AFD08288
UniProt: H8KWV9
Position
complement(3860297..3863737)
Genome map
AA seq 1146 aa AA seqDB search
MKIRKVLIANRGEIAIRIARACNELNIQTVAVYTYEDRYSLHRYKADEAYQIGEDNDPLK
PYLNIDEIIRIAKQSKADAIHPGYGFLSENKDLAQKCADNGIIFVGPRPDVMEALGDKVI
AKENARKAQIPIIDDNEKELTDFSVALEEANRIGYPLMLKAAAGGGGRGMRVIRNDEELE
KGFREARSEAKNAFGDDTVFLEKYIENPKHIEIQIVADSHGTIRHLFERDCSVQRRFQKV
VEVAPSVGLKEETRNKLYEYAIKICSTVNYNNVGTVEFLVDGKENIFFIEVNPRVQVEHT
VTEMVTGVDIIKTQLYIADGYKLSDPEIGLGDQRNIKCNGYAMQCRITTEDPANGFKPDY
GTLITYRNATGFGVRLDEGSTYPGMKISPFFDSMLVKVSTSGNDLSDAARKMHRALREFR
IRGVKNNIQFLENLISVPEFVEGKATVGFINEHPELFQFKTRLDRGTRILNYLADVSVNG
NPDVTMVNPNARFDKPIIPSYDQNAPYQKGTKDLLTELGPEKFADWLKSEKKIHYTDTTF
RDGHQSLLATRMRTYDMLKVAEAFAKNHPQTFSMEVWGGATFDVCIRFLREDPWKRLELL
RAAIPNILLQMLIRGCNGVGYSAYPDNLIESFVEKSWEKGVDIFRIFDSLNWMENIAPCI
DMVRKRTGGIAEGALCYTGDILDPKKTKYTLNYYLQLAKDLENAGAHILAIKDMSGLLKP
YAAKELVTALKETVKIPIHLHTHDTSSLQPATYLKAIEAGVDVVDCALGSLSGLTSQPNF
NAIVEMMRFHERENEYDIKSLNQHSTYWEAVREYYYPFESGMKASSAEVFQHEIPGGQYS
NLKGQAIALGLGERFEMIKERYAEVNELFGDIVKVTPSSKVVGDMAQFMVSNNLTKDDIL
TKGESISFPESVMQFFLGEIGQPAGGFPAQLQKIVLKDKQPYSDRPNKHLPAINFDKELE
AFKNQFGHDLQFTDFLSYKFYPKVFEDGLKFWREYGDVSTVPTKYFLYGMKQGEESTIEI
APGKTLLVRLLSISPADENGMRTVFFKLNGQTRNIDVQDKSIKVLKQENRKVDKGNDNHI
GAPLQGLLSKIFVKEGEKVKKNQPLFVVEAMKMETNITANHDFTIGSLVLAPGTLVNTDD
LVLEIN
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaggaaagtactcattgctaacagaggcgagattgccattcgcattgcgcgg
gcttgtaatgaactcaacattcaaactgttgcggtttatacctacgaagaccgctattcg
ctgcatcgatataaagctgacgaagcttatcagatcggtgaagataatgatcccctaaaa
ccttaccttaacattgatgagattatccgcattgcgaagcaaagcaaagctgatgctatt
catcccggttacggattcctttcagaaaataaggacctcgcacaaaagtgtgcagacaat
ggtattattttcgttggtccgcgtccggatgttatggaggccttaggagataaggttatt
gctaaagaaaatgcccgtaaagcgcaaattcctatcattgatgataatgagaaagagttg
accgactttagcgttgcgcttgaagaagcaaatagaattggttacccgcttatgttgaaa
gccgctgctgggggcggaggtagaggtatgcgtgtgatcaggaatgatgaagaattggag
aaggggtttcgcgaggcaagaagtgaagcaaaaaacgcttttggtgatgataccgttttc
cttgaaaaatacatcgaaaatccaaaacacatcgagatacagatagtagcagatagccat
gggactattcgccatctatttgaaagggattgttctgttcaacgtcgtttccagaaggtg
gttgaggttgctccttctgttggtcttaaagaagaaaccaggaataagctttatgaatat
gctatcaaaatatgttcaactgtaaattataataacgtaggtacagttgagtttttggtt
gatggtaaagagaacatttttttcattgaggtaaatccgcgtgtgcaggttgaacataca
gtaaccgaaatggttactggagtggatattattaaaacacagctatacatagcggatggc
tataagctttctgatccggaaattggtcttggtgatcaacgtaatatcaagtgcaatggt
tatgcaatgcaatgccgtattaccactgaggatcctgcaaatggattcaaaccggattat
ggcacactgattacttatcgtaacgctaccggttttggtgttcgtctagacgaaggatct
acctatccaggaatgaaaatcagtccattctttgactccatgttggttaaggtaagcacc
tctggtaatgatttaagtgatgcagctcgtaaaatgcatcgtgcacttagagagttccgt
attcgtggtgtaaaaaacaatattcagtttcttgaaaaccttatttcggttcccgaattt
gttgaagggaaagcgactgtagggtttatcaacgaacatcctgaattatttcagtttaaa
acccgtctcgaccgtggtactcggatcctgaattacctggctgatgtttctgtaaacgga
aacccggatgtaacaatggtaaatcccaatgctcgttttgataaaccgattattccatca
tatgaccagaatgctccatatcagaaaggaaccaaagatctgttgacagagcttggtcct
gagaagtttgcagattggttaaagagcgaaaagaaaattcattatacggatacaactttc
agagacggtcaccagtcgttgctggctacgcgtatgcgtacctatgatatgctgaaagtg
gcagaggcatttgctaaaaatcatccacaaacattctctatggaggtttggggtggagca
acgtttgatgtttgcatccgtttcttgcgcgaagatccttggaaacgattagaattattg
cgtgcggctatcccgaacattttattacaaatgctgattcgtggttgtaacggtgtgggc
tattccgcatatccagacaacctgatcgaaagctttgtagaaaaatcatgggaaaaaggg
gtagatatcttccgcatttttgactccttaaactggatggaaaacattgctccatgtatt
gatatggttcgcaaacgtaccggaggtattgctgaaggtgctttgtgttacactggtgat
attctggacccgaaaaaaacaaaatacacgcttaattattaccttcagttagcaaaagat
ctggaaaatgccggagctcatattcttgccatcaaagatatgtctggtttattaaaaccg
tatgctgcaaaagaactggttactgcattaaaagaaacagtaaaaattccgatccattta
catacgcatgatacttcgtcattgcaacctgctacttatttaaaggctattgaggctgga
gtggatgttgtagattgtgctttgggttcgctttcaggattaacatcgcaaccaaatttt
aatgccattgttgagatgatgcgtttccatgaacgggaaaacgaatacgatattaagtca
ttgaatcagcattctacttattgggaagcagttcgtgaatattattatccgtttgaatcg
ggaatgaaggctagttcggcggaggtatttcaacatgagattccgggcggacagtattca
aaccttaaaggacaggctattgcgttgggtttaggcgagcgttttgagatgattaaagaa
cgttatgctgaagtgaatgaattgttcggtgatatcgtaaaggttacgcccagttcaaag
gttgtgggcgatatggcgcaattcatggtttcgaataatctcactaaggatgatatacta
acaaagggagagtcaatttcattccctgaatcggtgatgcagttttttcttggtgaaatc
ggacagcccgcaggtggttttccagcgcaactacaaaagatcgttttaaaggataaacag
ccttattcggatcggccgaataaacatttgccagctattaactttgataaagaattggag
gcattcaagaatcagttcgggcatgatctgcagtttaccgattttctttcttataaattc
tatccgaaagtatttgaagatggtttgaaattttggcgtgaatatggagatgtttccact
gttcctaccaagtatttcttgtacggaatgaaacagggtgaagaatcaacgattgagatt
gctcctggaaaaacgttacttgttcgattgttaagtattagtcccgcagatgagaatgga
atgcggacagtattttttaaattaaacggtcaaacacgtaatattgatgtacaggataaa
tcgatcaaggttcttaaacaagagaatcgtaaggttgataaaggaaacgacaatcatatt
ggagctcctttgcaaggcttgctttcgaaaatatttgtgaaagaaggagaaaaagtaaag
aagaatcagccattatttgtagtagaagccatgaaaatggaaaccaatattacggctaat
catgattttactattggtagcctggtgttagctcctggaaccttagtaaatacagatgat
ttggttttagaaatcaattag

DBGET integrated database retrieval system