KEGG   Solitalea canadensis: Solca_3896Help
Entry
Solca_3896        CDS       T02084                                 

Definition
(GenBank) uncharacterized protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
scn  Solitalea canadensis
Brite
KEGG Orthology (KO) [BR:scn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Solca_3896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF3859
Motif
Other DBs
NCBI-ProteinID: AFD08891
UniProt: H8KLK4
Position
complement(4544140..4544526)
Genome map
AA seq 128 aa AA seqDB search
MVTKITDGVKISVETVYQPEYSNPANSHFMFAYKITIENLTDYTVQLMRRHWYIFDSNGT
HREVEGEGVVGQQPVIDPGETHEYVSGCNLTTEIGSMKGTYGMTRLVDGVQFEVNIPEFQ
LISPYRLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggttactaaaattacagacggtgttaaaatttcggtagaaaccgtatatcaaccggaa
tattcaaatccggcaaacagtcattttatgtttgcctataaaatcaccatagaaaatctt
acggattatacggtacaactaatgcggagacattggtatatatttgactcaaatggcaca
caccgtgaagtggaaggtgagggtgttgttggtcagcaacctgttattgacccaggagaa
acacacgaatatgtttctggttgcaatttaactacagaaataggctcaatgaaaggaact
tatggaatgactcgattagtagatggagttcagttcgaagtaaatattcccgaatttcag
ttaatcagtccttatcggttgaattaa

DBGET integrated database retrieval system