KEGG   Streptomyces coelicolor: SCO0046Help
Entry
SCO0046           CDS       T00085                                 

Gene name
SCJ4.27
Definition
(RefSeq) hydrolase
  KO
K01118  FMN-dependent NADH-azoreductase [EC:1.7.1.17]
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCO0046 (SCJ4.27)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.17  FMN-dependent NADH-azoreductase
     SCO0046 (SCJ4.27)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_2 FMN_red
Motif
Other DBs
NCBI-GeneID: 1095479
NCBI-ProteinID: NP_624404
Kitasato: SCO0046
UniProt: Q9S1U6
Position
36816..37478
Genome map
AA seq 220 aa AA seqDB search
MATLLHIDSSVFPAEASASRSVTAAFRRTWEEQHPEGTVIYRDLAAVPVPHITADAWSAG
YADPSERSTRQSAAFAARLELIEELERADVILIGAPMYNYTVPSTLKAWLDSVLLLGRTA
GEAPSAQGTPTVVVASRGGSYAPGTPREDFEFVQNYLEAVLRSTLGLDLEFIVPELTMAP
RNPAMSELLPLFESSRERAHSEAVTKAKELTERLTADNGR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcttctgcacatcgactcgtccgtgttcccggccgaggcgtccgcgtccagg
tccgtcacggccgcgttccgccgaacctgggaggagcagcacccggagggcacagtgatt
taccgcgacctcgccgccgtcccggtcccgcacatcaccgcggacgcctggtccgccggt
tacgccgacccgtccgagcgcagcacgcgccagtccgccgcgttcgccgcgcgcctggag
ctcatcgaggagctggagcgggcggacgtcatcctgatcggggcgcccatgtacaactac
acggtcccatccaccctcaaggcgtggctggacagcgtgctcctgctcggccgcacggcc
ggcgaggcaccctccgcacagggcacccccaccgtggtggtcgccagccgcggcggctcc
tacgcgccgggcaccccgcgcgaagacttcgagttcgtgcagaactacctggaggccgtt
ctgcgcagcaccctggggctggacctggagttcatcgtcccggaactcaccatggccccg
cgcaatccggccatgtccgaactgctcccgctcttcgaaagttcgcgggagcgcgcccac
agtgaggcggtcaccaaggcgaaggagctcaccgaacgtctcaccgcggacaacggcagg
tga

DBGET integrated database retrieval system