KEGG   Streptomyces coelicolor: SCO0199Help
Entry
SCO0199           CDS       T00085                                 

Gene name
SCJ12.11c
Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00071  Fatty acid degradation
sco00350  Tyrosine metabolism
sco00625  Chloroalkane and chloroalkene degradation
sco00626  Naphthalene degradation
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO0199 (SCJ12.11c)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCO0199 (SCJ12.11c)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SCO0199 (SCJ12.11c)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCO0199 (SCJ12.11c)
   00626 Naphthalene degradation
    SCO0199 (SCJ12.11c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SCO0199 (SCJ12.11c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 1095623
NCBI-ProteinID: NP_624534
Kitasato: SCO0199
UniProt: Q9RI47
Position
complement(188864..189886)
Genome map
AA seq 340 aa AA seqDB search
MKAAVVREFGKPLVIEDRPDPEPGPGQVLVAVEASGLCHTDIHAAHGDWPVKPTPPFVPG
HEGVGLVEKLGDGVTHLAVGQRVAVPWLGKACGRCEHCRSGWETLCEDQVNTGYGCDGGY
AEKMLAWADFAQPVPEGVSALDAAPLTCAGVTTYKALKVAEVGPAQLVAVSGVGGLGHLA
VQYAKIAGARVVAIDVTDDKLQLARELGADLVIDARTQDVGAELKRHGGAHAALALAVNP
AAFQAVNSGLRRGGKLVMVALPAHGTLQVPIFDTVLNGTSVIGSIVGTRQDLAEVFQLHA
EGRTKVIRETRPLAAVNDCIDEVLGGQVKARIVFDLNAGG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcggtcgtccgggagttcggcaagcccctggtcatcgaggacaggcccgac
ccggagcccggtccggggcaggtgctcgtggccgtcgaggcatccggcctgtgccacacc
gacatccacgccgcccacggcgactggccggtcaagcccaccccgccgttcgtccccggg
cacgagggcgtcggcctggtcgagaagctgggcgacggcgtgacccacctcgccgtcgga
caacgcgtcgccgtgccctggctcggcaaggcgtgcgggcggtgcgagcactgccggtcc
ggctgggagaccctgtgcgaggaccaggtcaacaccgggtacggctgcgacggcgggtac
gccgagaagatgcttgcctgggccgacttcgcgcagccggtgcccgagggcgtcagcgcc
ctcgacgccgccccgctcacctgcgcgggcgtcaccacctacaaggcactgaaggtcgcc
gaagtcgggcccgcccagctcgtcgccgtctcgggcgtgggcggactggggcacctcgcg
gtgcagtacgcgaagatcgccggagcgcgggtcgtcgcgatcgacgtcaccgacgacaaa
ctccaactcgcccgggaactcggcgccgacctcgtcatcgacgcccgcacccaggacgtc
ggcgccgagctgaagcgacacggcggcgcgcacgccgccctcgccctcgcggtgaacccg
gccgccttccaggccgtcaactccggtctgcggcgcggcgggaaactcgtcatggttgcc
ctgccggcgcacggcaccctccaggtcccgatcttcgacaccgtcctcaacggcacctcg
gtcatcggctccatcgtcggcacccggcaggatctcgccgaggtcttccaactccacgcc
gagggccgcacgaaggtcatccgggagacccgtccgctcgccgccgtcaacgactgcatc
gacgaggtcctcggcggacaggtcaaggcccggatcgtgttcgatctcaacgcgggaggc
tga

DBGET integrated database retrieval system