KEGG   Streptomyces coelicolor: SCO0217Help
Entry
SCO0217           CDS       T00085                                 

Gene name
narH2
Definition
(RefSeq) nitrate reductase subunit beta NarH2
  KO
K00371  nitrate reductase / nitrite oxidoreductase, beta subunit [EC:1.7.5.1 1.7.99.-]
Organism
sco  Streptomyces coelicolor
Pathway
sco00910  Nitrogen metabolism
sco01120  Microbial metabolism in diverse environments
sco02020  Two-component system
Module
sco_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SCO0217 (narH2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCO0217 (narH2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     SCO0217 (narH2)
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     SCO0217 (narH2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Nitr_red_bet_C Fer4_6 Fer4_7 Fer4_10 Fer4_2 Fer4_9 Fer4 Fer4_4 Fer4_21 Fer4_15 Fer4_8 Fer4_17
Motif
Other DBs
NCBI-GeneID: 1095641
NCBI-ProteinID: NP_624550
Kitasato: SCO0217
UniProt: Q9RI31
Position
210183..211751
Genome map
AA seq 522 aa AA seqDB search
MSRDEATVGRVMAQVAMVMNLDKCIGCHTCSVTCKQTWTNRTGVEYAWFNNVETKPGVGY
PRRYEDQDRWKGGWMLDRRGRLVLRSGGRVRRLLSLFSNPDLPSLEDYYEPVTYDYDNLV
GAPAGPDMPVARPRSVLTGRPTSITWGANWEDGLGGAPENAGADPNLSGEWAERVRFEFE
QTFLFHLPRLCEHCLNPACVSACPSGAMYKRVEDGIVLVDQDKCRGWRMCVTACPYKKVY
VNHATGKAEKCTFCFPRIEAGQPTVCSETCVGRLRYLGLLLYDADRVGEAAATPDEKDLL
DAQRGVFLDPADPDVIAAARESGIPEDWLAAARRSPVYDLVARHKVALPLHPEYRTLPMV
WYVPPLSPVLDAVDAAGGNQDDPDHVFAAVTRLRIPLEYLAELFTAGDTDVVGGVLMKLT
ALRSYMRARTLGEDGDEAALKAVGLTAREAEDLHRLLAVAKYEDRYVVPAAHREDAAALS
GMEDRCPVETSGDPQPAGSGGRIMLGIPTLRRSSAASTGDSA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgagacgaagccaccgtcggacgcgtcatggcacaggtcgcgatggtgatgaac
ctcgacaagtgcatcggctgccacacctgctcggtcacctgcaagcagacgtggaccaac
cgcaccggcgtcgagtacgcctggttcaacaacgtcgagaccaagcccggcgtcggctac
ccccgccgctacgaggaccaggaccggtggaagggcggctggatgctcgaccggcgtggg
cgtctcgtcctgcgctccggcggccgggtcaggcggctgctgtcgctgttctccaatccg
gacctgccctccctggaggactactacgagccggtcacctacgactacgacaacctggtc
ggcgcccccgccggaccggacatgccggtggcccgcccccgctcggtcctcaccggcagg
cccacctccatcacctggggcgccaactgggaggacgggctcggcggcgcccccgagaac
gccggcgccgaccccaacctcagcggcgagtgggccgagagggtcaggttcgagttcgag
cagaccttcctcttccacctcccgaggctgtgcgagcactgcctcaacccggcctgcgtg
tcggcctgcccgtccggcgcgatgtacaagcgggtcgaggacggcatcgtcctggtcgac
caggacaagtgccgcggctggcggatgtgcgtgaccgcgtgcccgtacaagaaggtgtac
gtcaaccacgccaccggcaaggccgagaagtgcacgttctgcttcccgcggatcgaggcc
ggccagcccaccgtctgctccgagacctgcgtggggcggctgcgctacctcggtctcctg
ctgtacgacgccgaccgggtcggcgaggccgccgccacccccgacgagaaggacctgctg
gacgcccagcgcggcgtcttcctcgacccggccgaccccgacgtcatcgcggcggcccgg
gagtcgggcatcccggaggactggctggcggccgcccgccgctcccccgtgtacgacctg
gtcgcacggcacaaggtggccctgccgctgcacccggagtaccgcaccctgccgatggtc
tggtacgtacccccgctgtcgcccgtcctggacgccgtcgacgcggcgggcggcaaccag
gacgacccggaccacgtgttcgcggccgtcacccggctgcgcatccccttggagtacctg
gcggagctgttcaccgccggggacaccgacgtggtcggcggggtgctgatgaagctcacc
gcgctgcgctcctacatgcgcgcacgcacgctgggcgaggacggcgacgaggccgcgctg
aaggcggtggggctgaccgcccgcgaggccgaggacctgcaccgcctgctggccgtcgcc
aagtacgaggaccggtacgtcgtaccggccgcgcacagggaggacgccgcggcgctgagc
gggatggaggaccgctgccccgtcgagacgtccggggatccgcaaccggccgggtccggc
ggccggatcatgctcggcatccccaccctgcgccgctcctcggccgcctcgacgggagac
tccgcatga

DBGET integrated database retrieval system