KEGG   Streptomyces coelicolor: SCO0293Help
Entry
SCO0293           CDS       T00085                                 

Gene name
SC5G9.02
Definition
(RefSeq) beta-xylosidase
  KO
K17641  beta-xylosidase
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    SCO0293 (SC5G9.02)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like DUF11
Motif
Other DBs
NCBI-GeneID: 1095717
NCBI-ProteinID: NP_624621
Kitasato: SCO0293
UniProt: Q9RL24
Position
285714..288104
Genome map
AA seq 796 aa AA seqDB search
MNADVTVDHTAEVSPWNDTTASVAARVDALIDAMTLREKTAQLYGVWVGASDEGGEVAPH
QHDMEEAVDLDALLPTGLGQLTRPFGTVPVDPALGALSLARTQARITATNRFGIPALAHD
ECLAGFAAWGATAYPVPLSWGATFDPDTVGRMASAIGRDMRAVGVHQGLAPVLDVVRDAR
WGRVEETIGEDPYLVGTIGTAYVRGLESAGIVATLKHFVGYSASRAGRNLAPSSMGPRER
ADILLPPFEMAIREGGARSVMNAYTDTDGVPSAADEELLTGLLRDTWSFDGTVVADYFAI
AFLKTLHGVAAEWADAAGLALRAGVDVELPGVKTYGAPLAEAVADGRVPETLVDRALRRT
LTQKARLGLLDPDWNPLPAALEGADLDDPAALRGRIDLDSPANRALARTVAEEAVVLLSN
DGTLPLARPRRIALLGPNADEAVAVLGCYSFPQHIGVRYPGTPHGIELPTLRVALAAEFP
DARITFARGTGVDDGDLTGLPEAVRVAREADIALVVLGDRAGLFGRGTSGEGCDVETLAL
PGAQQRLLDALLDLGTPLVTVLLAGRPYSLGRAVEESAAIVQSFFPGEEGTHAIAGVLSG
RVNPSGRLPVGVPRGPGSQPATYLGAKLAHAGEVSSIDPTPAFPFGHGLSYTRFDWTDLS
VDDQEAPTDGEFTLTFTVRNTGGRSGTEVVQLYLHDPVASVVQPVQRLVGYARVDLEPGE
ARRLRVTVPADLASFTGRDGRRVVEPGALELRLAASSADPRLTARVALTGVERHLDHTRR
LRSVVEQEPAARARAE
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccgacgtgaccgtagaccacaccgccgaagtctccccctggaacgacaccact
gcttccgtcgccgcgagagtcgacgccctgatcgacgcgatgaccctgcgggagaagacc
gcccagctgtacggagtctgggtgggcgcctccgacgagggcggtgaagtggcgccccac
cagcacgacatggaggaggccgtcgatctcgacgcgctcctgcccaccggactgggccag
ctgacccggcccttcggcaccgtcccggtcgaccccgccctgggtgcgctctccctggcc
cgcacccaggcccggatcaccgccacgaaccggttcggcatccccgctctcgcgcacgac
gagtgtctggccggcttcgccgcctggggtgcgacggcctaccccgtcccgctgtcctgg
ggtgccaccttcgaccccgacacggtggggcgcatggcctcggccatcgggcgggacatg
cgtgccgtcggcgttcaccaggggctcgcgcccgtcctggacgtggtccgcgacgcccgc
tggggccgggtcgaggagaccatcggcgaggacccgtacctcgtcggcaccatcggcacc
gcgtacgtgcggggtctcgagtcggccgggatcgtcgccaccctcaagcacttcgtcggg
tactcggcctctcgcgccggacgcaacctcgctccctcctccatgggcccgcgggagcgc
gccgacatcctgctgccccccttcgagatggcgatccgtgaaggcggcgcacggtcggtg
atgaacgcctacaccgacaccgacggcgtcccctccgcggccgacgaggaactgctcacc
gggctgctgcgcgacacgtggagcttcgacggcaccgtcgtcgccgactacttcgccatc
gccttcctgaagaccctgcacggtgtggcggccgagtgggccgacgccgccggtctggcg
ctgcgggcgggcgtcgacgtcgaactgcccggcgtcaagacatacggcgcgcccctggcg
gaggccgtcgccgacggccgtgtcccggagacgttggtcgaccgggcccttcgccggaca
ctcacccagaaggcgcggctcggcctgctcgatccggactggaaccccctgccggccgcg
ctcgaaggggcagacctcgacgatccggcggccctgcgcggccggatcgacctggacagt
ccggcgaaccgcgcactggcccgcacggtggccgaggaagccgtcgtgctgttgagcaac
gacggcacgctgccgctcgcgaggccgcgccgcatcgccctgctcggccccaacgccgac
gaggccgtcgccgtactgggctgctattcctttccccagcacatcggcgtccggtacccc
gggaccccgcacggcatcgagctgcccacgctgcgggtggcgctcgccgccgagttcccc
gacgctcggatcacgttcgcccgcggcaccggcgtcgacgacggggatctcaccggcctc
cccgaggccgtccgggtggcacgcgaggccgacatcgctctggtggtgctcggcgaccgc
gccgggctcttcgggcggggcaccagtggggaaggctgcgacgtcgagacgctggcactg
cccggggcacagcagcggttgctcgacgccctgctggacctggggacgcccttggtcacc
gtgctgctcgcgggacgaccgtactccctcggccgtgccgtcgaggagtccgcggcgatc
gtgcagtccttctttcccggtgaggaaggcacccacgcgatcgccggtgtgctcagcggc
cgcgtcaacccgtccgggcggctcccggtgggggtgccgcgcgggccggggtcccagccg
gccacctacctcggagcgaagctcgcccacgccggcgaggtgtccagcatcgacccgaca
ccggcgttccccttcggtcacggcctgtcctatacccggttcgactggacggacctgagc
gtggacgaccaggaggcaccgacggacggcgagttcaccctcaccttcaccgtccgcaac
accggcgggcggtccgggaccgaggtcgtccagctctatctgcacgacccggtcgcctcc
gtcgtccagccggtgcagcggctcgtcggctacgcccgggtcgacctggagcccggtgag
gcccggcggctgcgtgtcaccgtcccggccgatctcgcctcgttcaccggacgcgacgga
cggcgtgtggtcgaaccgggcgcgctggagctgaggctggccgcctccagcgcggaccca
cggctgaccgcgagggtcgcactgaccggagtcgaacggcacctggaccacacgcggcgc
ctgcgctccgtggtcgagcaggagccggctgcccgtgcccgagccgagtga

DBGET integrated database retrieval system