KEGG   Streptomyces coelicolor: SCO0379Help
Entry
SCO0379           CDS       T00085                                 

Gene name
katA
Definition
(RefSeq) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
sco00380  Tryptophan metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO0379 (katA)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SCO0379 (katA)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     SCO0379 (katA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-GeneID: 1095802
NCBI-ProteinID: NP_624701
Kitasato: SCO0379
UniProt: Q9RJK9
Position
393498..394961
Genome map
AA seq 487 aa AA seqDB search
MPENNQKPLTTVAGAPVPDNQNSLTSGPRGPMLLQDVWFLEKLAHFDREVIPERRMHAKG
SGAFGTFTVTHDITRYTSAKIFSEIGKKTPLFTRFSTVAGERGAADAERDIRGFAVKFYT
DEGNWDLVGNNTPVFFFRDPLKFPDLNHAVKRDPRTNLRNAENNWDFWTNLPEALHQVTI
VMSDRGIPASYRHMHGFGSHTYSLINAEGERFWVKFHHRTQQGIKNLTDAEAEALVGKDR
ESHQRDLFDAIEDGDFPKWKLFIQVMPEADAENYRFHPFDLTKVWSKKDYPLIEVGEWEL
NRNPDNYFADVEQAAFSPANVVPGISFSPDRMLQGRLFSYGDAQRYRLGVNHHQIPVNAP
KNPVNSYHRDGAMRVDGNQGATPGVEPNSYGRWQEQPAYRDPAQAVGAVADRFNYREDDD
NYFEQPGNLFRQMSPEQQQVLFENTARAIDGASAQTIERHIGNCTQADPAYGAGVRKAIE
ALAAGNL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgagaacaaccagaagccgctgaccacggtcgccggtgcgccggttcccgacaac
cagaactccctgacctccggcccgcgcggcccgatgctcctgcaggacgtgtggttcctg
gagaagctcgcgcacttcgaccgggaggtcatcccggagcgccggatgcacgcgaagggc
tcgggcgccttcggcaccttcaccgtcacccacgacatcacccggtacaccagcgcgaag
atcttctccgagatcggcaagaagaccccgctgttcacccggttctccaccgtcgccggt
gagcgcggtgccgccgacgccgagcgcgacatccgcggcttcgccgtgaagttctacacg
gacgagggcaactgggacctggtcgggaacaacaccccggtcttcttcttccgcgacccg
ctgaagttcccggacctcaaccacgcggtcaagcgcgacccgcgcaccaacctgcgcaac
gccgagaacaactgggacttctggaccaacctccccgaggccctgcaccaggtcacgatc
gtgatgtcggaccgcggcatcccggcctcctaccggcacatgcacgggttcggctcgcac
acgtacagcctgatcaacgccgagggcgagcggttctgggtcaagttccaccaccgcacc
cagcagggcatcaagaacctcaccgacgccgaggccgaggccctggtcggcaaggaccgc
gagtcccaccagcgcgacctcttcgacgcgatcgaggacggcgacttcccgaagtggaag
ctgttcatccaggtcatgccggaggccgacgcggagaactaccgcttccaccccttcgac
ctcaccaaggtctggtcgaagaaggactacccgctgatcgaggtcggcgagtgggagctc
aaccgcaaccccgacaactacttcgcggacgtggagcaggccgccttcagcccggccaac
gtggtcccgggcatcagcttctcccccgaccggatgctgcagggccgcctcttctcctac
ggcgacgcccagcgctaccgcctcggcgtcaaccaccaccagatcccggtcaacgccccg
aagaacccggtgaactcctaccaccgcgacggcgccatgcgcgtcgacggcaaccaggga
gccaccccgggcgtcgagcccaactcctacggccgctggcaggagcagccggcctaccgc
gacccggcccaggccgtgggcgccgtcgccgaccggttcaactaccgcgaggacgacgac
aactacttcgagcagcccggcaacctgttccggcagatgagcccggagcagcagcaggtt
ctgttcgagaacacggcacgcgccatcgacggcgcctcggcgcagaccatcgagcgccac
atcggcaactgcacccaggccgacccggcctacggcgcgggcgtccgcaaggcgatcgag
gccctggccgccggcaacctctga

DBGET integrated database retrieval system