KEGG   Streptomyces coelicolor: SCO0386Help
Entry
SCO0386           CDS       T00085                                 

Gene name
SCF62.12
Definition
(RefSeq) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00250  Alanine, aspartate and glutamate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO0386 (SCF62.12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sco01002]
    SCO0386 (SCF62.12)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SCO0386 (SCF62.12)
Peptidases [BR:sco01002]
 Cysteine Peptidases
  Family C44
   SCO0386 (SCF62.12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 tRNA_Me_trans NAD_synthase DUF1933
Motif
Other DBs
NCBI-GeneID: 1095809
NCBI-ProteinID: NP_624708
Kitasato: SCO0386
UniProt: Q9RJK2
Position
403034..404968
Genome map
AA seq 644 aa AA seqDB search
MCGIAGTYHWPDGKAVTDRLTDVLAHRGPDGAGRYSHPAGEGEVHLGHRRLAVVDLSTTG
AQPMVSEGLALSYNGELYNAPELRTELESAGVRFRGTSDTEVVLEAWRRWGTDCLPQLRG
MFAFAVFDERTGELVLARDQLGIKPLFLLRRGAGLVFASELKALATATGGKLEVDHAALV
ASLLYYWVPDSRCALREAEKLPPGSWLRCRPDGRVERGRFWNLRDVAAEGRERARSGERP
DLAAVVEESTRRHLLSDVPVATFLSGGLDSSYLTALAARDRPGISAYTIGFRAEDARFEA
MPDDLRYARQVAERFGVDLHEIEIAPNVLDLLPRMTYHLDEPIGDPAAINTFLICSAARE
AGVKVMLSGMGADELFAGYRKHLANVLALRYQRVPRPLRRGVSAAVGRLPVASSRRGYRS
VRFAKRFLSFADLPQETAFRRSYTMYDRQELLDLIDPDLAGTVEDVLTEHADVYEDNDLD
DFVNRMCLADARMFLPGLNLAYTDRSSMAASTEVRVPYVDVEVVKAAFAVPGDRKIVGRQ
GKAVLKEAATSVLPREIVYRPKGLFSAPLRAWMSRDLAPLVREVVNDGELVRSGFLRRDA
LRRLVAEDAAGQRDFSKHLWHVLTLEYWYRGATSGSGDHSSSTA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcgcaggcacgtaccactggccggacggcaaggccgtgaccgaccggctc
accgacgtcctcgcccaccgcggtccggacggggcgggccgctacagccatcccgccggc
gagggcgaggtgcacctcgggcaccgtcggctggccgtcgtcgacctgtccacaaccggc
gcccagccgatggtctcggagggcctcgccctgtcgtacaacggcgagctgtacaacgcg
cccgagctgcgcaccgagctggagtcggccggggtccgcttccgcggcacctccgacacg
gaggtggtcctggaggcctggcggcgctggggcacggactgtctgccgcagctgcgcggc
atgttcgcgttcgcggtcttcgacgagcgcaccggtgaactggtgctcgcccgcgaccag
ctcggcatcaagccgctgttcctgctccggcgcggcgcgggcctggtgttcgcctccgag
ctcaaggcgctcgccaccgcgaccggcgggaagctggaggtggaccacgcggcgctggtg
gcctcgctgctgtactactgggtgccggactcgcgctgcgcgttgcgcgaggcggagaag
ctgccgccgggcagctggctgcggtgccggcccgacggccgggtggagcgcggccggttc
tggaatctgcgggacgtcgccgccgagggccgggagcgggcccgcagcggcgagcggccg
gacctggccgccgtcgtcgaggagtcgacccggcgccacctgctctccgacgtgccggtg
gcgacgttcctctccggcgggctggactccagctacctgaccgcgctggcggcccgcgac
cggcccgggatctccgcctacacgatcgggttccgcgccgaggacgccaggttcgaggcg
atgcccgacgacctgcgctacgcccggcaggtggccgagcggttcggcgtcgacctgcac
gagatcgagatcgccccgaacgtgctcgacctgctgccgcggatgacgtaccacctggac
gagccgatcggcgaccccgccgcgatcaacaccttcctgatctgctcggccgcccgggag
gccggggtcaaggtgatgctctcggggatgggcgccgacgagctgttcgccggctaccgc
aagcacctggccaacgtgctggcgctgcgctaccagcgcgtcccgcggccgctgcggcgc
ggggtgtccgcagccgtgggccggctgccggtcgcgtcgagccgccgggggtaccggtcg
gtgcgcttcgcgaagcggttcctgtccttcgccgatctgccgcaggagaccgccttccgg
cgcagctacacgatgtacgaccgtcaggagctgctcgacctgatcgatccggatctggcg
ggcacggtcgaggacgtgctgaccgagcacgcggacgtctacgaggacaacgacctcgac
gacttcgtgaaccgcatgtgcctggccgacgcccggatgttcctgccgggcctgaacctc
gcctacacggaccgctccagcatggccgcgtcgaccgaggtgcgggtgccgtacgtggac
gtcgaggtggtgaaggcggcgttcgccgtgcccggtgaccgcaagatcgtcgggcggcag
ggcaaggccgtcctgaaggaggcggccacctcagtactgccccgggagatcgtgtaccgg
cccaagggcctgttcagcgccccgctgcgggcctggatgagccgtgacctggcgccgctg
gtgcgcgaggtggtgaacgacggcgaactcgtcaggtcggggttcctgcgccgggacgcg
ctgcggcggctcgtcgccgaggacgccgccgggcagcgggacttctccaaacacctgtgg
cacgtgctgaccctcgagtactggtaccgcggcgcgacctccgggtccggcgaccactcc
tcgtcgacggcctag

DBGET integrated database retrieval system