KEGG   Streptomyces coelicolor: SCO0524Help
Entry
SCO0524           CDS       T00085                                 

Gene name
SCF11.04
Definition
(RefSeq) gluconolactonase
  KO
K01053  gluconolactonase [EC:3.1.1.17]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco00053  Ascorbate and aldarate metabolism
sco00930  Caprolactam degradation
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO0524 (SCF11.04)
   00053 Ascorbate and aldarate metabolism
    SCO0524 (SCF11.04)
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SCO0524 (SCF11.04)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO0524 (SCF11.04)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.17  gluconolactonase
     SCO0524 (SCF11.04)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SCO0524 (SCF11.04)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Arylesterase Str_synth DUF5073
Motif
Other DBs
NCBI-GeneID: 1095947
NCBI-ProteinID: NP_624838
Kitasato: SCO0524
UniProt: Q9RK85
Position
555990..556898
Genome map
AA seq 302 aa AA seqDB search
MSTDGPYEILDDRFRTGRCANGDNRLEVLYDGCRWAEGPLYLPAWRQLVWSDIPNDRILR
WDEATGSVGVFRAPAGHSNGNTLDRQGRLVTCEQGNRRVTRTEPDGRVTVLAERFDGRRL
NSPNDSVVRSDGTIWFSDPDFGITSDYEGHRAESEIGACNVYRIDPVSGQVRLAADGFDG
PNGVILTPDERRLFVSDSRAARIHAFDIREDGTLSDGKVFAEGRGDVHFDNIRFDDEGRL
WAAALHDGVHCYDPDGTLIGRLRVPEPVSNVAFGGPKNNRLFITATTSLYSLVMSVTGAP
RL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgacggcccgtacgagatcctggacgaccgcttccgcaccggacgctgtgcg
aacggagacaacaggctggaggtcctgtatgacggctgccgctgggccgagggcccgctg
tacctccccgcctggcgtcagctggtctggagcgacatccccaacgaccgcatcctgcgc
tgggacgaggccaccggctcggtcggcgtcttccgcgctcccgcgggccacagcaacggc
aacaccctcgaccggcagggccgcctggtcacctgcgagcagggcaaccggcgcgtcacc
cgtaccgaacccgacgggagggtgaccgtcctggccgagcgcttcgacggcaggcggctg
aacagtccgaacgactccgtcgtccgctccgacggcaccatctggttctccgacccggac
ttcggcatcaccagcgactacgagggtcatcgcgccgagtccgagatcggcgcgtgcaac
gtgtaccggatcgacccggtgtccgggcaggtgcggctcgccgccgacggtttcgacggg
cccaacggcgtgatccttacccccgacgagcggcggctgttcgtctccgactcgcgggcc
gcccggatccacgcgttcgacatccgggaggacggcacgctctccgacgggaaggtcttc
gccgagggccggggggacgtgcacttcgacaacatccgcttcgacgacgagggccgcctg
tgggccgccgccctgcacgacggtgtccactgctacgaccccgacggcacgctcatcggc
cgtctgcgcgtgcccgagcccgtctccaacgtcgccttcggcggccccaagaacaaccgc
ctgttcatcacggccaccacgtccctgtactccctggtgatgtcggtgacgggggcaccg
cgcctctga

DBGET integrated database retrieval system