KEGG   Streptomyces coelicolor: SCO0541Help
Entry
SCO0541           CDS       T00085                                 

Gene name
SCF11.21
Definition
(RefSeq) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
sco  Streptomyces coelicolor
Pathway
sco00052  Galactose metabolism
sco00561  Glycerolipid metabolism
sco00600  Sphingolipid metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SCO0541 (SCF11.21)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SCO0541 (SCF11.21)
   00600 Sphingolipid metabolism
    SCO0541 (SCF11.21)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SCO0541 (SCF11.21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 1095964
NCBI-ProteinID: NP_624855
Kitasato: SCO0541
UniProt: Q9RK69
Position
573756..575081
Genome map
AA seq 441 aa AA seqDB search
MSTAHPSAPKITFVGAGSVVFTQGLLADLFAFDELKSAHIALHDIDAERLATARAAAEYI
AAERGARPRVTAHADRREALAGADFVINIVQVGMGEATRTDFEVPARYGLRQTIGDTLGV
GGIFRALRTFPLLKALGEDIAEVCPDAWLLNYTNPMAMNVQYLAEATGLTRVVGLCHSVY
WTVQGLCELLKVPYEEVTYQAAGVNHQAWVLRLEHGGEDLHPRLDALIAEDPQLRRRVRM
DMYRRLGHYPTETSEHSSEYVPWYLHHDSEVERLRLPVGAYLGIVDENVAEYERTRDALA
CGAPLTVEGTMEYAPQIIHSMVTGTPRTVYGNVPNHGLIENLPARGTVEVPCLVDSAGLQ
PTRVGALPPQLAALNRAYLSTTDLVVRAATEDDPRHIRHAAMADPATAATLRVEEIWQLC
DDMVRAHGDRLQPGLRGVLAP
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcccacccgtccgcacccaagatcaccttcgtcggagccggcagcgtcgtc
ttcacccagggtctgctcgccgacctcttcgccttcgacgagctgaagtccgcgcacatc
gcgctgcacgacatcgacgcggagcgcctggccaccgcgcgggccgccgccgagtacatc
gccgccgaacgcggcgcccggccgcgcgtcaccgcgcacgccgaccgtcgcgaggccctg
gccggcgccgacttcgtcatcaacatcgtgcaggtcggcatgggcgaggcgacccgtacc
gacttcgaggtcccggcccgctacgggctgcgccagaccatcggcgacaccctcggcgtc
ggcggcatcttccgcgccctgcgcaccttcccgctgctcaaggcgctcggcgaggacatc
gccgaggtctgcccggacgcctggctgctcaactacaccaacccgatggcgatgaacgtc
cagtacctcgccgaggcgaccggcctgacgcgcgtggtgggactgtgccactccgtgtac
tggacggtccagggtctgtgcgagctgctgaaggtcccctacgaggaggtcacctaccag
gccgcgggcgtcaaccaccaggcgtgggtgctgcgtctggagcacggcggcgaggatctc
cacccgcgcctggacgcgctgatcgccgaggacccgcagctgcggcgccgggtccgcatg
gacatgtaccggcggctcggccactacccgacggagaccagcgagcactcctccgagtac
gtgccctggtacctgcaccacgacagcgaggtcgagcggctgcggctgcccgtcggtgcc
tatctgggcatcgtggacgagaacgtggccgagtacgagcggacccgcgacgcgctggcg
tgcggcgcgccgctcaccgtcgagggcaccatggagtacgcgccgcagatcatccacagc
atggtgaccggcacgccccgcacggtctacggcaacgtgccgaaccacggtctgatcgag
aacctgcccgcccggggcaccgtcgaggtgccgtgcctggtcgactccgcgggcctccag
cccacccgcgtcggtgcgctgcccccgcagctcgccgccctcaaccgggcctacctcagc
accaccgacctggtggtgcgggcggcgacggaggacgacccgcggcacatccggcacgcg
gcgatggccgacccggcgacggcggcgaccttgcgggtcgaggagatctggcagctgtgc
gacgacatggtccgggctcacggggaccggctgcagccggggctgcggggcgtactcgcc
ccctga

DBGET integrated database retrieval system