KEGG   Streptomyces coelicolor: SCO0546Help
Entry
SCO0546           CDS       T00085                                 

Gene name
pyc, SCF11.26c
Definition
(RefSeq) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00620  Pyruvate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO0546 (pyc)
   00620 Pyruvate metabolism
    SCO0546 (pyc)
Enzymes [BR:sco01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     SCO0546 (pyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp ATP-grasp_3 RnfC_N GCV_H ATP-grasp_4 NQRA
Motif
Other DBs
NCBI-GeneID: 1095969
NCBI-ProteinID: NP_624860
Kitasato: SCO0546
UniProt: Q9RK64
Position
complement(583523..586897)
Genome map
AA seq 1124 aa AA seqDB search
MFRKVLVANRGEIAIRAFRAGYELGARTVAVFPHEDRNSLHRLKADEAYEIGEQGHPVRA
YLSVEEIVRAARRAGADAVYPGYGFLSENPELARACEEAGITFVGPSARILELTGNKARA
VAAAREAGVPVLGSSAPSTDVDELVRAADDVGFPVFVKAVAGGGGRGMRRVEEPAQLREA
IEAASREAASAFGDSTVFLEKAVVEPRHIEVQILADGEGDVIHLFERDCSVQRRHQKVIE
LAPAPNLDPALRERICADAVNFARQIGYRNAGTVEFLVDRDGNHVFIEMNPRIQVEHTVT
EEVTDVDLVQSQLRIAAGQTLADLGLAQENITLRGAALQCRITTEDPANGFRPDTGQISA
YRSPGGSGIRLDGGTTHAGTEISAHFDSMLVKLSCRGRDFTTAVNRARRAVAEFRIRGVA
TNIPFLQAVLDDPDFQAGRVTTSFIEQRPHLLTARHSADRGTKLLTYLADVTVNKPHGER
PELVDPLTKLPTASAGEPPAGSRQLLAELGPEGFARRLRESSTIGVTDTTFRDAHQSLLA
TRVRTKDMLAVAPVVARTLPQLLSLECWGGATYDVALRFLAEDPWERLAALREAVPNLCL
QMLLRGRNTVGYTPYPTEVTDAFVQEAAATGIDIFRIFDALNDVEQMRPAIEAVRQTGSA
VAEVALCYTADLSDPSERLYTLDYYLRLAEQIVNAGAHVLAVKDMAGLLRAPAAATLVSA
LRREFDLPVHLHTHDTTGGQLATYLAAIQAGADAVDGAVASMAGTTSQPSLSAIVAATDH
TERPTGLDLQAVGDLEPYWESVRKVYAPFEAGLASPTGRVYHHEIPGGQLSNLRTQAVAL
GLGDRFEDIEAMYAAADRMLGRLVKVTPSSKVVGDLALHLVGAGVSPADFEQDPDRFDIP
DSVVGFLRGELGTPPGGWPEPFRSKALRGRAEARPLAELSEDDRDGLGKDRRATLNRLLF
PGPAREFDTHRASYGDTSILDSKDFFYGLRPGKEYTVDLDPGVRLLIELQAVGDADERGM
RTVMSSLNGQLRPIQVRDRSAATDVPVTEKADRANPGHVAAPFAGVVTLAVAEGDEVEAG
ATVATIEAMKMEASITAPKSGTVTRLAINRIQQVEGGDLLVQLA
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcaaggtgctggtcgccaaccgcggtgagatcgcgatccgtgcgtttcgggcg
ggctacgagctcggcgcgcgcaccgtcgccgtcttcccgcacgaggaccgcaattcgctg
caccggctcaaggccgacgaggcctacgagatcggggagcaggggcatcccgtccgcgcg
tacctctccgtggaggagatcgtgcgcgccgcccgccgtgcgggggccgacgccgtctac
ccgggctacggcttcctgtccgagaaccccgaactcgcccgcgcctgcgaggaggccggg
atcaccttcgtcggtcccagcgcccggatcctggaactgaccggcaacaaggcacgggcc
gtggccgccgcccgcgaggccggagtacccgtgctcggctcctcggcgccctccaccgac
gtggacgaactcgtacgcgccgccgacgacgtcggcttccccgtgttcgtcaaggcggtc
gcgggcggcggcgggcgcggcatgcgccgcgtcgaggaacccgcccagctgcgcgaggcc
atcgaggccgcctcccgcgaggccgcgtccgccttcggcgactccaccgtcttcctggag
aaggcggtcgtcgaaccccgccacatcgaggtgcagatcctcgccgacggcgagggcgac
gtcatccacctcttcgagcgggactgctcggtgcagcgccgccaccagaaggtgatcgag
ctggcgcccgcgcccaacctcgacccggccctgcgggagcggatctgcgccgacgccgtg
aacttcgcccggcagatcggctaccgcaacgcgggcaccgtcgagttcctcgtcgaccgg
gacggcaaccacgtcttcatcgagatgaacccgcgcatccaggtcgagcacacggtcacc
gaggaggtcaccgacgtcgacctggtccagtcccagctgcgcatcgccgccggccagacg
ctggccgacctcggactcgcccaggagaacatcaccctgcgcggtgccgcactccagtgc
cgcatcaccaccgaggacccggccaacggcttccgcccggacaccgggcagatcagcgcc
taccgttcgccgggcggctccggcatccggctcgacggcggtaccacccacgccggtacg
gagatcagcgcgcacttcgactcgatgctggtcaagctctcctgccggggacgggacttc
accaccgcggtgaaccgcgcccggcgtgcggtcgccgagttccgcatccgcggcgtcgcc
accaacatccccttcctccaggcggtcctggacgaccccgacttccaggccggccgggtc
accacctcgttcatcgaacagcgcccgcacctgctgaccgcccggcactccgccgaccgc
ggcaccaagctgctgacctacctcgccgacgtcacggtgaacaagccgcacggcgagcgc
cccgagctggtcgacccgctgaccaagctgccgacggcgtccgccggtgaaccgcccgcc
gggtcccgccagttgctggccgagctggggccggaggggttcgcccgccgactgcgcgag
tcgtccaccatcggcgtcaccgacaccaccttccgcgacgcccaccagtcgctgctcgcc
acccgggtgcgcaccaaggacatgctcgccgtggcgcccgtcgtcgcccgcaccctgccc
cagctgctgtccctggagtgctggggcggcgccacctacgacgtcgccctgcgcttcctc
gccgaggacccctgggagcggctagccgcgctgcgcgaggcggtgcccaacctctgcctc
cagatgctgctgcgcggccgcaacaccgtgggctacaccccgtacccgaccgaggtgacc
gacgccttcgtgcaggaggccgccgccaccggcatcgacatcttccgcatcttcgacgcc
ctcaacgacgtcgagcagatgcggcccgccatcgaggccgtacggcagaccggcagcgcc
gtcgccgaggtcgcgctctgctacaccgccgacctgtccgacccctccgagcggctctac
accctcgactactacctgcggctcgccgagcagatcgtgaacgccggagcgcacgtgctg
gccgtcaaggacatggccgggctgctgcgcgcaccggccgccgcgaccctggtgtccgcg
ctgcgccgggagttcgacctgccggtgcacctgcacacccacgacaccaccggcggccag
ctcgccacctacctggccgcgatccaggcgggcgcggacgccgtcgacggtgcggtggcg
tccatggcgggcaccacttcgcagccgtcgctgtcggcgatcgtggccgccaccgaccac
accgagcggcccaccggcctcgacctccaggccgtcggcgacctggagccgtactgggag
agcgtccgcaaggtctacgccccgttcgaggccggcctggcctccccgaccggccgggtc
taccaccacgagattcccggcggccagctctccaacctgcgcacccaggccgtcgcgctc
ggcctcggcgaccgcttcgaggacatcgaggccatgtacgccgccgccgaccggatgctg
ggccgcctggtgaaggtcaccccgtcctccaaggtggtcggcgacctggccctgcatctg
gtgggcgccggtgtctccccggcggacttcgagcaggaccccgaccggttcgacatcccg
gactccgtggtcggcttcctgcgcggcgagctgggcaccccgcccggcggctggcccgag
ccgttccgcagcaaggcgctgcgcggccgcgccgaggccaggccgctcgccgagctgtcc
gaggacgaccgcgacggcctcggcaaggaccgccgggcgacgctcaaccggctgctgttc
ccgggaccggcccgcgagttcgacacccaccgcgcctcgtacggcgacaccagcatcctc
gacagcaaggacttcttctacgggctgcgcccgggcaaggagtacacggtcgacctcgac
cccggcgtccggctgctcatcgaactccaggcggtcggcgacgccgacgagcgcggcatg
cgcaccgtgatgtcctccctgaacggacagctccgccccatccaggtccgcgaccggtcg
gccgccaccgacgtcccggtgacggagaaggccgaccgggcgaaccccggccacgtcgcg
gcgccgttcgccggtgtggtgaccctcgccgtcgccgagggcgacgaggtggaggccggg
gccaccgtggccaccatcgaggcgatgaagatggaggcgtcgatcacggccccgaagtcc
ggcacggtgaccaggctcgccatcaaccgcatccagcaggtcgagggcggcgatcttctc
gtccaactcgcctga

DBGET integrated database retrieval system