KEGG   Streptomyces coelicolor: SCO0548Help
Entry
SCO0548           CDS       T00085                                 

Gene name
fabB2, SCF11.28c
Definition
(RefSeq) 3-oxoacyl-ACP synthase
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
sco  Streptomyces coelicolor
Pathway
sco00061  Fatty acid biosynthesis
sco00780  Biotin metabolism
sco01100  Metabolic pathways
sco01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SCO0548 (fabB2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SCO0548 (fabB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sco01004]
    SCO0548 (fabB2)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     SCO0548 (fabB2)
Lipid biosynthesis proteins [BR:sco01004]
 Fatty acid synthase
  Component type
   SCO0548 (fabB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-GeneID: 1095971
NCBI-ProteinID: NP_624862
Kitasato: SCO0548
UniProt: Q9RK62
Position
complement(587985..589271)
Genome map
AA seq 428 aa AA seqDB search
MSPRHAAGPAPGERAAVVTGLGLTTSLGGDVPSTWRALLDGGCGVERVDFGEPAGPAQVY
LAAPAAVDPGTVLSSAKAAHCDRSAQFALVAAREAVRDAGFPDPSALAGDGSRVAVVVGV
GLGGLTSVLEQDHRLRTQGAGRVSPRTIPVMLPNHAAAEVGLMVGAKAGVHAPVSACAAG
AEALAQALGMIRDGRADIVVAGGTEAALHPLVLAGFARLRALSRRHDDPKGASRPFDADR
DGFVMGEGAGMLVVESAAHAAARGARVHGRLTGAGITNDSHHVAQPAPGGPGCAAAVDAA
LRDAGLVPEQIQHVNAHATATPLGDLGEAQALHSVFAKGVDDVTVSATKGAFGHTLGAAG
AIEAVLTVLALRDRTAPPACSLERVDPEIGLNVVGRDPATLPCGPLAAVSTSMGFGGHNV
ALAFADAS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccacgacacgcggccggcccggcccccggggagcgggccgccgtcgtcacgggg
ctggggctgaccacctcgctgggcggcgacgtcccctccacctggcgggccctgctggac
ggcgggtgcggcgtcgaacgcgtcgacttcggcgagccggccgggcccgcacaggtgtac
ctcgcggccccggccgcggtcgaccccgggacggtcctgtcgtccgccaaggcggcgcac
tgcgaccgctcggcgcagttcgccctcgtggccgcccgcgaggccgttcgcgacgcgggg
ttccccgacccgtccgcgctcgccggggacgggtcgcgggtggccgtggtcgtcggggtg
gggctgggcggcctcaccagcgtcctggagcaggaccaccgcctgcggacgcagggcgcg
gggcgggtgagcccgcgcaccatcccggtcatgctgcccaaccacgcggccgccgaagtg
gggctcatggtgggcgcgaaggccggggtgcacgcgcccgtcagtgcctgcgccgccggt
gccgaggccctcgcccaggccctcggcatgatccgggacggccgcgcggacatcgtggtc
gcgggcggcaccgaggccgcgctgcatccgctggtcctggccgggttcgcgcggctgcgg
gccctctcccggcgccacgacgatcccaagggggcctccaggcccttcgacgccgaccgg
gacggcttcgtgatgggggagggcgccggcatgctcgtggtcgagagcgccgcgcacgcc
gccgcccgcggcgcccgcgtccacggccggctcaccggggcgggcatcaccaacgacagc
caccacgtggcccagccggcgcccggcggtccgggctgcgcggcggccgtcgacgccgca
ctgcgcgacgcggggctcgtgccggagcagatccagcacgtcaacgcccacgccaccgcc
acaccgctcggcgacctcggcgaggcgcaggcgctgcacagcgtcttcgccaagggcgtg
gacgacgtcacggtcagcgccaccaagggggccttcggacacaccctcggtgccgccgga
gccatcgaggccgtcctcaccgtcctcgccctgcgggacagaacggcaccgccggcctgc
agcctcgaacgggtcgaccccgagatcggcctgaacgtcgtcggccgcgacccggcgaca
ctgccctgcgggcccctcgcggccgtcagcacgagcatgggcttcggcgggcacaacgtc
gcgctcgccttcgccgacgcctcatga

DBGET integrated database retrieval system