KEGG   Streptomyces coelicolor: SCO0572Help
Entry
SCO0572           CDS       T00085                                 

Gene name
SC5G5.04c
Definition
(RefSeq) cytosine permease
  KO
K10974  cytosine permease
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO0572 (SC5G5.04c)
Transporters [BR:sco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SCO0572 (SC5G5.04c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transp_cyt_pur
Motif
Other DBs
NCBI-GeneID: 1095995
NCBI-ProteinID: NP_624885
Kitasato: SCO0572
UniProt: Q93RZ8
Position
complement(613751..615151)
Genome map
AA seq 466 aa AA seqDB search
MAMHKNPAGGAAAAEAATGAVGSDDYALSRVPRDKRLGFWTMLLQWLAQSGSISQFTLGA
TIGVGMTFGDAFLAFTLGAVILEVVIFAIGLAGMREGLATPLLTRWAGFGRNGSALVSLV
ISVSLVGWFGVQNTIFGDSVSALVGGPSWLWCTAAGVAITVLVIFGFKYMAVFAKIVTPL
FFAMVAWSVTDALSDHSFSELIHSPAPGETIPLAVAATAIAGGFMTGAIVSPEMTRYNRK
GSHVFLQSASSMILSEYIVGLTGVLLGHLVGSGQVSQIVLSTSGVFGVLVVLMSTAKIND
WNLYGSSLGVVNFFQVVFGKRVHRGAVTIVLGIAGTLLSAVGIMTHFTDFLSVLGVAIPP
VGGIIVAEYWVVRRMRAPLDATRDAETLPATSPTWVPMSLVIWAAAFCVGKFYDGGIPAL
NSLLTAFVLYCVLGLAGWIRPYGTTALDDTDEPTPAATGTATVGAP
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcacaagaaccccgccggcggggccgccgccgcggaagcggccacgggagcc
gtgggcagcgacgactacgccctctcccgcgtcccgcgcgacaagcggctcggcttctgg
accatgctgctgcagtggctcgcgcagtccggctccatctcgcagttcaccctcggcgcc
accatcggcgtcggcatgaccttcggcgacgccttcctcgcgttcaccctcggcgcggtg
atcctcgaagtcgtgatcttcgcgatcggcctcgcgggcatgcgcgaggggctcgccacc
ccgctgctcacccgctgggcgggcttcggccgcaacggctccgcgctggtcagcctggtc
atctcggtcagcctcgtcggctggttcggggtgcagaacacgatcttcggcgacagcgtg
tccgcgctcgtcggcggtccctcctggctgtggtgcacggccgccggtgtcgccatcacg
gtgctggtcatcttcggcttcaagtacatggccgtcttcgcgaagatcgtcacgccgctg
ttcttcgccatggtcgcctggtcggtcaccgacgcgctgagcgaccactcgttctccgaa
ctgatccactccccggcgcccggcgagaccatcccgctcgccgtcgccgcgaccgccatc
gcgggcggcttcatgaccggcgcgatcgtctccccggagatgacccggtacaaccgcaag
ggcagccacgtcttcctgcagagcgcctcgtcgatgatcctctccgagtacatcgtcggc
ctgaccggtgtcctgctcggccacctggtcggcagcggccaggtctcccagatcgtgctc
tccacctccggcgtcttcggcgtgctcgtcgtcctgatgtccaccgcgaagatcaacgac
tggaacctgtacggctcctcgctcggcgtcgtcaacttcttccaggtcgtcttcggcaag
cgcgtgcaccggggcgcggtcaccatcgtcctcggcatcgcgggcaccctgctctccgcc
gtcggcatcatgacccacttcaccgacttcctgtccgtgctgggcgtcgccatcccgccg
gtgggcggcatcatcgtcgccgagtactgggtggtgcgccgcatgcgggcacccctggac
gccacccgcgacgcggagaccctgccggccacctcgccgacctgggtgcccatgtccctg
gtcatctgggcggccgccttctgcgtcggcaagttctacgacggcggcatccccgccctg
aactccctgctgaccgccttcgtcctctactgcgtcctcggcctcgccggctggatcagg
ccatacggcaccaccgccctggacgacaccgacgaacccaccccggccgccaccggcacg
gccaccgtaggagcaccgtga

DBGET integrated database retrieval system