KEGG   Streptomyces coelicolor: SCO0579Help
Entry
SCO0579           CDS       T00085                                 

Gene name
SCF55.03c
Definition
(RefSeq) ribose 5-phosphate isomerase
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco00051  Fructose and mannose metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sco_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO0579 (SCF55.03c)
   00051 Fructose and mannose metabolism
    SCO0579 (SCF55.03c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     SCO0579 (SCF55.03c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB Gly_rich_SFCGS
Motif
Other DBs
NCBI-GeneID: 1096002
NCBI-ProteinID: NP_624891
Kitasato: SCO0579
UniProt: Q9RJR1
Position
complement(620367..620879)
Genome map
AA seq 170 aa AA seqDB search
MTDKLRIVVGSDDAGHQYKEALKQDLRGSALVAEVTDVGVDADGHTAYPKVAIAAAEMVA
RGEADRALLVCGTGLGVAIAANKVRGIRAVTAHDSFSVERAILSNNAQVLTFGQRVVGLE
LARRLAAEWLTYRFDENSASAAKVQLMSDYETADDAGAASGSAADGGAAA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagctccgcatcgtcgtcggctccgacgacgccggccaccagtacaaggaa
gccctcaagcaggacctgcgcggcagcgccctggtcgccgaggtcaccgacgtcggcgtc
gacgccgacggccacaccgcctacccgaaggtggccatcgccgccgccgagatggtcgcc
cggggcgaggccgaccgcgccctgctggtgtgcggcaccggcctcggcgtcgccatcgcc
gccaacaaggtcaggggcatccgggccgtcaccgcccacgactccttctccgtcgagcgg
gcgatcctctccaacaacgcccaggtcctcaccttcggccagcgcgtcgtcggcctcgaa
ctcgcccgccgcctcgccgccgagtggctcacctaccgcttcgacgagaactcggcgtcg
gccgccaaggtccagctgatgagcgactacgagaccgccgacgacgccggtgcggcgagc
gggagcgcggccgacggcggggcggccgcctga

DBGET integrated database retrieval system