KEGG   Streptomyces coelicolor: SCO0681Help
Entry
SCO0681           CDS       T00085                                 

Gene name
SCF15.02
Definition
(RefSeq) ferredoxin/ferredoxin-NADP reductase
  KO
K00528  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCO0681 (SCF15.02)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     SCO0681 (SCF15.02)
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     SCO0681 (SCF15.02)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 NAD_binding_9 NAD_binding_8 HI0933_like FAD_binding_3 FMO-like
Motif
Other DBs
NCBI-GeneID: 1096104
NCBI-ProteinID: NP_624989
Kitasato: SCO0681
UniProt: Q9RK35
Position
723181..724545
Genome map
AA seq 454 aa AA seqDB search
MPRPLRVAIVGSGPAGIYAADALLKSEVAADPGVSIDIFERMPAPFGLIRYGVAPDHPRI
KGIITALHQVLDKPQIRLFGNVNYPTDVSLDDLRAFYDGVIFATGATADRDLSLPGIDLD
GSYGAADFVAWYDGHPDFPRTWPLEAEKVAVLGVGNVALDIARVLAKTADELLPTEIPPN
VYEGLKANKALEVHVFGRRGPAQAKFSPMELRELDHSPNIEVIVDPEDIDYDEGSIATRR
GNKQADMVAKTLENWAIRDVGDRPHKLFLHFFESPAEILGEDGRVTGLRTERTELDGTGN
VKGTGEFKDWDVQAVYRAVGYLSDQLPKLPWDLETGTVPDAGGRVVQESGEHLQSTYVTG
WIRRGPIGLIGHTKGDANETVSNLLDDYANGRLQTPSSPAPEAVDAFLAERNVRFTTWDG
WYRLDAAEKAQGEPHGRERVKYVEREDMLRESGA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccctctgcgggtagccatcgtcggatccggcccggccgggatctacgccgcc
gacgccctgctcaagtccgaagtggccgccgaccccggtgtttccatcgacatcttcgag
cgcatgcccgccccgttcggcctcatccggtacggcgtcgcgcccgaccacccgcggatc
aagggcatcatcacggccctccaccaggtgctcgacaagccgcagatccgcctcttcggc
aacgtgaactaccccaccgacgtcagcctggacgatctgcgcgccttctacgacggtgtg
atcttcgccaccggcgccacggcggaccgggacctgtccctcccgggcatcgacctcgac
ggctcgtacggcgcggccgacttcgtcgcctggtacgacggccaccccgacttcccgcgc
acctggccgctggaggcggagaaagtcgccgtcctcggtgtcggcaacgtcgccctggac
atcgcgcgcgtcctcgccaagacggccgacgagctgctgccgaccgagatcccgccgaac
gtctacgagggcctcaaggccaacaaggcgctggaggtgcacgtcttcggccgccgcggc
ccggcgcaggcgaagttcagcccgatggagctgcgggagctggaccactcccccaacatc
gaggtgatcgtcgaccccgaggacatcgactacgacgagggctcgatcgcgacccggcgc
ggcaacaagcaggccgacatggtcgccaagaccctggagaactgggcgatccgcgacgtc
ggcgaccggccgcacaagctcttcctgcacttcttcgagtcgcccgcggagatcctcggc
gaggacggcagggtgaccggcctgcgcaccgagcgcacggagctggacggcacgggcaac
gtcaagggcaccggcgagttcaaggactgggacgtccaggcggtctaccgggccgtcggc
tacctctccgaccagctgcccaagctgccctgggacctcgagacgggcacggtcccggac
gcgggcggccgggtcgtccaggagtccggcgagcacctccagtcgacgtacgtcaccggc
tggatccggcgcggtccgatcggcctgatcggccacaccaagggcgacgccaacgagacg
gtgtccaacctgctggacgactacgcgaacggccgtctccagacgccctcctcccccgct
cccgaggccgtggacgcgttcctcgccgagcggaacgtccgcttcaccacctgggacggc
tggtaccggctcgacgccgcggagaaggcgcagggcgaaccgcacgggcgtgagcgcgtg
aagtacgtcgagcgcgaggacatgctccgcgagagcggcgcctga

DBGET integrated database retrieval system