KEGG   Streptomyces coelicolor: SCO0782Help
Entry
SCO0782           CDS       T00085                                 

Gene name
3SCF60.14c, prsA
Definition
(RefSeq) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco00230  Purine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO0782 (3SCF60.14c)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO0782 (3SCF60.14c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     SCO0782 (3SCF60.14c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran NIT UPRTase PRTase_2 MLTR_LBD BcsB
Motif
Other DBs
NCBI-GeneID: 1096205
NCBI-ProteinID: NP_625084
Kitasato: SCO0782
UniProt: Q9EWS0
Position
complement(828755..829708)
Genome map
AA seq 317 aa AA seqDB search
MRDIAVFSGSAHPDLAEEVCAQLGVPLSPTRVSRFANDCLEVQLMANCRERDVFLVQPLV
TPVQEHLVELLMMCDAARGASAGRITVVMPHYSYARSDKKDAPRISLGGRLVADLLVAAG
ASRVLAMTLHSPQVHGFFSVPVDHLHALRELAAHFRQYDLSRATVVSPDLGNAKEAAAFA
RMLGAQVAAGAKQRYADDRVSISSVIGDVAGRDVIVLDDEIAKGSTVLELLDRLRESGPR
TIRLACTHGLFAAGALGRLSEQPDVLEIVCTNTVPVPADDHTDKLRILSIAPALAEAVRR
IHNGESVSALFDARPAG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagacatcgccgtgttcagcggtagtgcccaccccgacctggccgaggaggtctgc
gcgcagctgggcgtgccgctcagccccacccgggtcagccggttcgccaacgactgcctc
gaggtgcagctgatggccaactgccgcgagcgggacgtgttcctcgtccagccgctggtc
acaccggtccaggagcacctcgtcgagctgctgatgatgtgcgacgcggcccgcggggcg
tcggccggccgcatcacggtggtcatgccgcactactcctacgcccgctccgacaagaag
gacgccccgcgcatctcgctgggcgggcgcctggtcgccgacctgctggtggcggcgggg
gcgagccgggtcctcgccatgaccctgcactcgccccaggtgcacggcttcttctccgtc
ccggtcgaccacctgcacgcgctgcgggaactggccgcgcacttccggcagtacgatctc
tcccgcgcgaccgtcgtctcgccggacctgggcaacgccaaggaggccgcggcgttcgcc
cggatgctcggcgcccaggtggcggccggggcgaagcagcggtacgccgacgaccgggtc
agcatcagctcggtgatcggggacgtcgcgggccgggacgtcatcgtgctcgacgacgag
atcgccaagggcagcacggttctggaactcctcgaccggctccgggagtcgggcccgcgc
accatccgcctcgcctgtacgcacgggctgttcgcggccggtgcgctgggccgcctcagc
gagcagccggacgtgctggagatcgtgtgcaccaacaccgtgccggtcccggcggacgac
cacacggacaaactgcggatcctgtccatcgccccggcgctcgccgaggcggtgcgccgc
atccacaacggcgagtcggtcagcgccctgttcgacgcccggccggccggctga

DBGET integrated database retrieval system