KEGG   Streptomyces coelicolor: SCO0884Help
Entry
SCO0884           CDS       T00085                                 

Gene name
SCM1.17c
Definition
(RefSeq) oxidoreductase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00020  Citrate cycle (TCA cycle)
sco00260  Glycine, serine and threonine metabolism
sco00280  Valine, leucine and isoleucine degradation
sco00620  Pyruvate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00640  Propanoate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO0884 (SCM1.17c)
   00020 Citrate cycle (TCA cycle)
    SCO0884 (SCM1.17c)
   00620 Pyruvate metabolism
    SCO0884 (SCM1.17c)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO0884 (SCM1.17c)
   00640 Propanoate metabolism
    SCO0884 (SCM1.17c)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO0884 (SCM1.17c)
   00280 Valine, leucine and isoleucine degradation
    SCO0884 (SCM1.17c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO0884 (SCM1.17c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SCO0884 (SCM1.17c)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SCO0884 (SCM1.17c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 Thi4 K_oxygenase HI0933_like Amino_oxidase Lycopene_cycl AlaDh_PNT_C GIDA
Motif
Other DBs
NCBI-GeneID: 1096307
NCBI-ProteinID: NP_625183
Kitasato: SCO0884
UniProt: Q9RD26
Position
complement(929779..931212)
Genome map
AA seq 477 aa AA seqDB search
MTQSDSLTYDVVVIGAGPVGENVADRTRAAGLSTAIVESELVGGECSYWACMPSKALLRP
VLARADARRLPGLAQSLQEPLDATAVLARRDEFTSHWKDDGQVQWVEGIGADLYRGQGRL
AGPRTVEVAGPDGTRRTLSARHAVAVCTGSAAALPPLPGLAEVRPWTSREATSAERAPGR
LIVVGAGVVAVEMATAWQALGSRVTMLVRGDGGLLARMEPFAGELVAEALTEAGVDIRTG
VSVESVTRENGTVVAVTDTGDRLEADEILFATGRTPRTGDIGLDTVGLKPGSWLPVDDSL
RVEGSDWLYAVGDVNHRALLTHQGKYQARIAGAAIAARASGVPILESDPWGAHAATADHD
AVPQVVFTDPEVASVGLTLAEAEQAGHRVRAVDVPIAVAGSSLYGDGYKGRARMVVDLED
EIVRGVTFVGPGVGEMIHSATIAVAGRVPISRLWHAVPSYPTISEVWLRLLETYRDN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatcggattccctcacgtacgacgtcgtcgtgatcggcgcgggccccgtcggc
gagaacgtcgccgaccgcacccgggcggccggactgtccaccgcgatcgtggagagcgaa
ctggtcggcggcgaatgctcctactgggcgtgcatgcccagcaaggccctgctgcgcccg
gtcctcgcccgcgcggacgcccgccgcctgcccggcctcgcccagtcgctccaggaaccc
ctcgacgccactgccgtcctcgcccgccgggacgagttcacctcgcactggaaggacgac
ggccaggtccagtgggtcgagggcatcggcgccgacctgtaccgcggacaggggcggctc
gccggaccgcgcacggtggaggtggccggtcccgacggcacccgccggaccctgtccgcc
cggcacgccgtcgccgtctgcaccggcagcgccgccgccctgcccccgctgcccggactc
gccgaggtacgcccctggaccagccgcgaggccaccagcgccgagcgcgcgcccggccgg
ctgatcgtcgtcggcgccggagtcgtcgccgtcgagatggccaccgcctggcaggccctc
ggctcccgggtgacgatgctggtgcgcggcgacggcggcctgctcgcccgcatggagccg
ttcgccggggaactggtcgccgaggcgctcaccgaggccggcgtggacatccgcaccggc
gtctccgtcgagtccgtcacccgcgagaacggcaccgtcgtcgccgtcaccgacaccggc
gaccgcctggaggccgacgagatcctcttcgccaccggccggacgccgcgcaccggcgac
atcggactggacaccgtcggcctgaagccgggttcctggctgccggtcgacgacagcctc
cgcgtggagggcagcgactggctctacgccgtcggcgacgtcaaccaccgcgccctcctc
acccatcagggcaagtaccaggcccgcatcgccggtgccgccatcgccgcccgcgcctcc
ggggtgccgatcctggagtccgacccctggggcgcgcacgccgcgaccgccgaccacgac
gccgtgccccaggtggtgttcaccgaccccgaggtcgcgtccgtcggcctgaccctggcc
gaggccgagcaggcgggacaccgggtccgcgccgtcgacgtccccatcgccgtggcgggg
tcgagcctgtacggcgacggctacaagggccgcgcccgcatggtggtcgacctggaggac
gagatcgtccgcggtgtcaccttcgtcggcccgggcgtcggcgagatgatccactccgcg
acgatcgccgtcgccggccgggtaccgatcagccgcttgtggcacgcggtcccctcgtac
ccgacgatcagcgaggtgtggctgaggctgctggagacctaccgggacaactga

DBGET integrated database retrieval system