KEGG   Streptomyces coelicolor: SCO0907Help
Entry
SCO0907           CDS       T00085                                 

Gene name
SCM1.40c
Definition
(RefSeq) dehydrogenase
  KO
K00020  3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
sco  Streptomyces coelicolor
Pathway
sco00280  Valine, leucine and isoleucine degradation
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO0907 (SCM1.40c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     SCO0907 (SCM1.40c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored ApbA IlvN 2-Hacid_dh_C NAD_Gly3P_dh_N 3HCDH_N Shikimate_DH OCD_Mu_crystall Glyco_trans_4_4 NAD_binding_8 Epimerase Rossmann-like 2-Hacid_dh Sacchrp_dh_NADP NmrA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 1096330
NCBI-ProteinID: NP_625206
Kitasato: SCO0907
UniProt: Q9RD04
Position
complement(951968..952858)
Genome map
AA seq 296 aa AA seqDB search
MTDQLTVSVLGTGIMGAAMARNLARAGHAVRVWNRSRAKAEPLAADGAHVAGSPEEAVRG
ADVVLTMLYDGPAALDVMRRAEPGLRPGTVWAQSTTAGVDAVADLAAYAHERGLVFFDAP
VLGTRQPAEAGQLLVLAAGPGEARDTVAPVFDAVGSRTVWTGEDGAAGSATRLKLVANSW
VLAVTNAGGETLSLAKALGVDPDTFFDAIAGGPLDMGYLRAKAGLIRDGALRPAQFAVAT
AEKDARLIVEAGEANGVRLDLAAAGAERFARAAAQGHGDEDMAAAYFASFEEKASD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccagctcaccgtgagcgtcctgggcaccggcatcatgggtgccgcgatggcc
cgcaacctcgcccgcgccggacacgccgtccgcgtctggaaccgcagccgcgccaaggcc
gagccgctggccgccgacggcgcgcatgtcgcgggcagcccggaggaggcagtacgcggc
gccgacgtcgtcctcacgatgctgtacgacggcccggccgccctcgacgtgatgcggcgg
gccgagcccggcctgcggcccggcaccgtgtgggcgcagtccaccaccgcgggcgtcgac
gcggtcgccgacctggccgcctacgcccacgagcggggcctcgtcttcttcgacgccccc
gtcctcggcacccggcagcccgccgaggccggtcagctgctggtgctggcggcgggtccg
ggcgaggcgcgcgacaccgtggcgcccgtgttcgacgccgtcggctcgcgcaccgtgtgg
accggagaggacggcgcggccggcagcgccacccggctgaaactggtggccaacagctgg
gtcctcgccgtcaccaacgccggcggcgagaccctctcgctcgccaaggccctgggcgtc
gacccggacaccttcttcgacgccatcgccggtggtccgctcgacatgggctacctgcgg
gccaaggccggcctgatccgcgacggcgcgctgaggccggcccagttcgccgtcgccacc
gccgagaaggacgcccgcctgatcgtcgaggccggcgaggcgaacggcgtccggctggac
ctcgccgcggccggtgcggaacgcttcgcccgggccgccgcccagggacacggcgacgag
gacatggcggcggcctacttcgccagtttcgaggagaaggcgagcgactga

DBGET integrated database retrieval system