KEGG   Streptomyces coelicolor: SCO0923Help
Entry
SCO0923           CDS       T00085                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00190  Oxidative phosphorylation
sco00650  Butanoate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sco_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO0923 (sdhA)
   00650 Butanoate metabolism
    SCO0923 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SCO0923 (sdhA)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SCO0923 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SCO0923 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 1096346
NCBI-ProteinID: NP_625221
Kitasato: SCO0923
UniProt: Q9RCY7
Position
complement(968638..970587)
Genome map
AA seq 649 aa AA seqDB search
MTTYADYTTGEPVADTKAPAGPVNERWDTRRFEAKLVNPANRRGKTVIVVGTGLAGGSAG
ATLAEQGYHVVQFCYQDSPRRAHSIAAQGGINAAKNYRNDGDSIHRLFYDTVKGGDFRSR
ESNVHRLAQISVEIIDQCVAQGVPFAREYGGLLDTRSFGGVQVSRTFYARGQTGQQLLLG
AYQALSRQIAAGTIEMHARTEMLDLIVVDGRARGIVARDLVTGKIDTYYADAVVLASGGY
GNVFYLSTNAMNSNATAVWRAHRRGAYFANPCFTQIHPTCIPRTGDHQSKLTLMSESLRN
DGRIWVPKAKGDDRPANKIPEDERDYYLERIYPSFGNLVPRDIASRAAKNVCDEGRGVGP
GGQGVYLDFADAIKRMGRKAVEAKYGNLFDMYQRITDEDPYRVPMRIYPAVHYTMGGLWV
DYDLQTTVPGLFAIGEANFSDHGANRLGASALMQGLADGYFVLPATINDYLARNPLGDDV
DDDHPVVQEVLAETEDRLNLLLSVDGDRTPDSFHRELGELMWEFCGMARTDSGLRKALER
IPQIREEFWRRIKVPGTGEEFNQSLEKANRIVDYLELAELMCLDALHRAESCGGHFREES
QTPDGEAARRDEEFGYAAAWEFTGTGDAPTLHKEDLVFEYVHPTQRSYA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctacgccgactacacgaccggggagccggtcgccgacaccaaggcccccgcc
ggacccgtcaacgagcgctgggacacgcgccgtttcgaggcgaagctggtcaaccccgcc
aaccggcgcggcaagaccgtcatcgtcgtcggcaccggcctcgcgggcggctccgcgggc
gcgaccctggccgaacagggctaccacgtcgtccagttctgctatcaggactccccgcgc
cgggcccactccatcgccgcgcagggcggcatcaacgccgcgaagaactaccgcaacgac
ggcgactcgatccaccgcctgttctacgacaccgtcaagggcggcgacttccgctcccgc
gagtccaacgtccaccggctggcgcagatctcggtcgagatcatcgaccagtgcgtggcg
cagggcgtgccgttcgcccgtgagtacggcggtctgctcgacacccgctccttcggcggc
gtgcaggtctcccgcaccttctacgcccgcggccagacagggcagcagctgctgctcggc
gcctaccaggcgctcagccggcagatcgcggccggcaccatcgagatgcacgcccgcacc
gagatgctcgacctgatcgtcgtcgacggccgggcccgcggcatcgtcgcccgggacctg
gtcaccgggaagatcgacacctactacgcggacgccgtcgtcctggccagcggcggctac
ggcaacgtcttctacctctccaccaacgccatgaactccaacgcgaccgccgtctggcgg
gcgcaccggcgcggtgcctacttcgccaacccctgcttcacgcagatccacccgacctgc
attccgcgcaccggcgaccaccagtccaagctgacgctgatgagcgagtcgctgcgcaac
gacggccggatctgggtgcccaaggccaagggcgacgaccggcccgcgaacaagatcccc
gaggacgagcgcgactactacctggagcgcatctacccgtccttcggcaacctggtcccg
cgcgacatcgcctcccgcgccgcgaagaacgtctgcgacgagggcaggggagtgggtccc
ggcggccagggcgtgtacctggacttcgccgacgcgatcaagcgcatgggccgcaaggcg
gtcgaggccaagtacggcaacctcttcgacatgtaccagcggatcaccgacgaggacccg
taccgggtgcccatgcggatctacccggcggtgcactacacgatgggcggactgtgggtc
gactacgacctccagaccaccgtccccggcctgttcgcgatcggcgaggccaacttctcc
gaccacggcgccaaccggctcggcgcctccgcgctgatgcagggcctggccgacggctac
ttcgtactgccggccaccatcaacgactacctcgcccgcaacccgctgggggacgacgtc
gacgacgaccacccggtggtccaggaggtgctggccgagaccgaggaccggctgaacctg
ctgctgtccgtggacggcgaccgcaccccggactccttccaccgggaactgggcgagctg
atgtgggagttctgcggcatggcccgcaccgactccggcctgcgcaaggccctggagcgc
atcccgcagatccgcgaggagttctggcggcgcatcaaggtccccggcaccggcgaggag
ttcaaccagtcgctggagaaggccaaccgcatcgtcgactacctggaactcgccgagctg
atgtgcctcgacgcgctgcaccgcgccgagtcctgcggcggccacttccgcgaggagtcc
cagaccccggacggcgaggcggcccgcagggacgaggagttcggctacgccgcggcctgg
gagttcaccggcaccggtgacgcccccaccctgcacaaggaagacctggtcttcgagtac
gtccaccccacccagcggagctacgcatga

DBGET integrated database retrieval system