KEGG   Streptomyces coelicolor: SCO0975Help
Entry
SCO0975           CDS       T00085                                 

Gene name
SCBAC19F3.02, zwf3
Definition
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco00480  Glutathione metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sco_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO0975 (SCBAC19F3.02)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SCO0975 (SCBAC19F3.02)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     SCO0975 (SCBAC19F3.02)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     SCO0975 (SCBAC19F3.02)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 NAD_binding_11 Shikimate_DH F420_oxidored ApbA 3HCDH_N adh_short 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 1096398
NCBI-ProteinID: NP_625271
Kitasato: SCO0975
UniProt: Q93J68
Position
1027393..1028832
Genome map
AA seq 479 aa AA seqDB search
MSTTAQIGVTGLAVMGRNLARNFARNGYTVAVHNRTASRTHALVEEFGSEGDFVATETAK
EFVAALERPRRLVIMVKAGDPTDAVIREFAPLLEPGDMIIDGGNAHFADTRRRERELREQ
GIHFVGTGISGGEEGALHGPSIMPGGSKESYESLGPMLEKISAKAADEAPCVTHVGPDGA
GHFVKMVHNGIEYADMQLIGEAYQLLRDVAGYSPAQIAEIFRAWNTGRLDSYLIEITAEV
LSHVDGATGKPFVDVVVDQAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSLSGHAALRD
ASRGLAGPQASPLGESEAAAFADRVEQALYASKIVSYTQGFHEIAAGSEEYDWDIDLGAV
SAIWRGGCIIRAAFLDRIRAAYDARPDLPSLLSDETFAQEIAAAQDDWREVLVAATRQGV
PTPGFAAALAYYDALRAERLPAALTQGQRDFFGAHTYRRTDRDGAFHTLWGGDRSEVTA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcactacagcgcagatcggcgtcacgggtctcgcggtcatgggccgcaacctcgcc
cgcaacttcgcccgcaacggctacacggtcgcggtgcacaaccggaccgcgtcgcgcacg
cacgcgctggtggaggagttcgggagcgagggcgatttcgtggcgaccgagaccgccaag
gagttcgtggccgcgctggagcgcccgcgacgcctggtgatcatggtgaaggcgggtgac
ccgaccgacgcggtgatccgggagttcgccccgctcctcgagcccggggacatgatcatc
gacgggggcaacgcgcacttcgcggacacccggcgccgggagcgcgaactgcgcgagcag
ggcatccatttcgtgggcaccggcatctcgggcggcgaggagggcgcgctgcacgggccc
agcatcatgccgggcggctcgaaggagtcgtacgagtctctgggcccgatgctggagaag
atctcggcgaaggccgcggacgaggcgccctgtgtgacgcacgtcggtcccgacggcgca
ggtcacttcgtcaagatggtgcacaacggcatcgagtacgccgacatgcagttgatcggc
gaggcgtaccagctgctgcgcgacgtcgccgggtactcccccgcgcagatcgcggagatc
ttccgcgcctggaacaccggccgcctggactcgtacctgatcgagatcacggcggaggtg
ctgtcgcacgtggacggggcgacgggcaagccgttcgtggacgtggtggtcgaccaggcg
gagcagaagggcaccggccgctggacggtgcagatcgcgctggacctgggcgtgccggtg
tcgggcatcgcggaggccgtcttcgcgcgctccctgtcggggcacgcggcgctgcgtgac
gcctcgcgcggcctggccggcccgcaggcgtccccgctcggcgagtcggaggcggccgcc
ttcgccgaccgcgtcgagcaggcgctgtacgcctcgaagatcgtgtcgtacacgcagggc
ttccacgagatcgccgcgggcagcgaggagtacgactgggacatcgacctcggcgccgtc
tcggcgatttggcgcggcggctgcatcatccgggcggccttcctggaccgcatccgggcg
gcctacgacgcccggccggacctgccgagcctgctgtcggacgagacgttcgcccaggag
atcgccgccgcgcaggacgactggcgcgaggtcctggtcgccgcgacccggcagggcgtg
ccgacgccgggcttcgccgccgccctcgcctactacgacgccctgcgcgccgagcggctc
cccgccgcgctgacccaggggcagcgggacttcttcggggcgcacacgtaccgcaggacg
gaccgggacggcgccttccacacgctgtggggcggtgaccggtccgaggtcaccgcgtag

DBGET integrated database retrieval system