KEGG   Streptomyces coelicolor: SCO0983Help
Entry
SCO0983           CDS       T00085                                 

Gene name
aceB2, SCBAC19F3.10
Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00620  Pyruvate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Module
sco_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO0983 (aceB2)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO0983 (aceB2)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SCO0983 (aceB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 1096406
NCBI-ProteinID: NP_625279
Kitasato: SCO0983
UniProt: Q93J61
Position
1035208..1036800
Genome map
AA seq 530 aa AA seqDB search
MSTTSLTHHVRVLAAPGPRHDEILTPAALDFVGGLVEAFQPRRRDLMKERRRLALRLASG
SPLDFPTVTSAVRNDPTWRVAPPAPGLTDRRVEITGPPDRRMAVNALNSGAQVWMADFED
ATAPLWDNIIGGQLTLLDVIERRIDFTTPEGKEYRLGDRPATIMVRPRGWHLDEEHLEYD
GRPVPATLVDFGLYFFHCAQRQIDAGHGPYFYLPKLENRYEARLWNDVFLTAQELLGIPR
GTVRATVLIETITAAFEMEEILHALREHSAGLNAGRWDYLFSIIKTFGHRTDFLLPDRAK
VTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAQVPGKDPAANEAAFAKVRLDKEREAEDG
FDGSWVAHPGLVPVCRDVFDAVLEDRPHQLDRDRHDVDVTPADLLSVRRVSAPPTPEGLR
TNIAVALRYFAAWLRGQGAVAIEGLMEDAATAEIARVQVWQWLRHRVVDREIALRMLDDE
IVALGAEYPYAPVDEIRTLFERTALTGELPLFFTPDAYARHLVRRVGDAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacctcactcacccaccacgtccgtgtcctcgccgcgcccggtccccggcac
gacgagatcctcacccccgccgccctggacttcgtcggcgggctcgtcgaggcgttccag
ccgcgccgacgggatctgatgaaggagcgccgcaggctcgccctgcggctggcgtcgggc
tcacccctcgacttccccacggtcacgtccgccgtgcgcaacgaccccacgtggcgcgtg
gcaccgcccgcgcccggcctgaccgaccggcgggtggagatcaccgggccgcccgaccgc
cgcatggccgtcaacgcgctcaactccggcgcccaggtgtggatggccgacttcgaggac
gccaccgcacccctgtgggacaacatcatcggcggccagctcaccctcctcgacgtcatc
gagcggcgcatcgacttcacgactccggagggcaaggagtaccggctcggtgaccggccg
gccaccatcatggtccgcccccgcggctggcacctcgacgaggagcacctggagtacgac
ggcaggcccgtacccgccacgctcgtcgacttcggcctgtacttcttccactgtgcccag
cggcagatcgacgccggccacggcccgtacttctatctgccgaagctggagaaccgctac
gaggcccggctgtggaacgacgtcttcctgacggcgcaggaactgctcggcatcccgcgc
ggcacggtccgggccaccgtcctcatcgagacgatcaccgcggcgttcgagatggaggag
atcctccacgcgctgcgcgaacacagcgccggcctcaacgccggccgctgggactacctc
ttcagcatcatcaagaccttcggccaccgcaccgacttcctcctccccgaccgggcgaag
gtcacgatgaccgcccccttcatgcgcgcgtacaccgaactcctcgtccgcacatgccac
aagcgcggcgcccacgccatcggcggcatggccgcccaggtccccggcaaggacccggcc
gcgaacgaggccgcgttcgccaaggtccgcctggacaaggagcgcgaggccgaggacggc
ttcgacggctcctgggtcgcccatcccggactcgtccccgtctgccgcgacgtcttcgac
gccgtcctcgaggacaggccccaccagctcgatcgcgaccgccacgacgtcgacgtcacc
cccgccgacctgctgtccgtgcgccgggtcagcgcaccgccgacccccgagggcctgcgc
accaacatcgccgtcgccctgcgctacttcgccgcctggctgcgcgggcagggagcggtc
gccatcgagggcctgatggaggacgcggccactgccgagatcgcccgcgtccaggtctgg
cagtggctgcggcaccgggtcgtcgaccgggagatcgcactgaggatgctggacgacgag
atagtcgcactcggcgccgagtacccgtacgccccggtggacgagatccggacgctcttc
gaacggaccgcgctgacaggcgaactgcccctgttcttcactccggacgcctacgcgcgt
cacctcgtgcgccgcgtcggggacgcggcatga

DBGET integrated database retrieval system