KEGG   Streptomyces coelicolor: SCO0984Help
Entry
SCO0984           CDS       T00085                                 

Gene name
SCBAC19F3.11
Definition
(RefSeq) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
sco  Streptomyces coelicolor
Pathway
sco00360  Phenylalanine metabolism
sco00362  Benzoate degradation
sco00650  Butanoate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO0984 (SCBAC19F3.11)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    SCO0984 (SCBAC19F3.11)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO0984 (SCBAC19F3.11)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     SCO0984 (SCBAC19F3.11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 F420_oxidored TrkA_N DAO Sacchrp_dh_NADP 2-Hacid_dh_C GIDA
Motif
Other DBs
NCBI-GeneID: 1096407
NCBI-ProteinID: NP_625280
Kitasato: SCO0984
UniProt: Q93J60
Position
1036797..1037666
Genome map
AA seq 289 aa AA seqDB search
MSGGIRRVGVVGGGRMGAGIAEVCARAGLDTVVCEADTVAARAARDRVAASLDRAVRRGT
LTQAAARDTLARMVFTGSLEDLADRQLVVEAVAENLDAKTEIFAALDKIVEDPAAVLASN
TSSLPVMRLGMATGRADRVVGLHFFNPVPVLPLVEVVASLHTSAATAAAAEDFATGTLGK
TVIRSQDRAGFVVNALLVPYLLSAIRMAESGFAIAADIDIGMELGCAHPMGPLKLADLIG
LDTVASIAESLYDEFKEPLYAPPPLLQRMVEAGLLGRKTGRGFHTYDRD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggggcatccgtcgcgtcggcgtggtcggcggtggccggatgggagcgggcatc
gccgaagtgtgtgcacgggcgggcctcgacacggtggtgtgcgaggcggacacggtcgca
gcccgcgccgcccgcgaccgggtggcggcctcactcgaccgcgcggtgcggcgcggcacg
ctgacccaggcggcggcccgggacacactcgcgcgcatggtgttcaccggcagtctggag
gacctcgccgaccggcagctcgtcgtcgaggccgtcgcggagaacctcgacgccaagacc
gagatcttcgccgccctcgacaagatcgtcgaagacccggcggccgtgctggcctccaac
acctcctccctgccggtcatgcggctcggcatggcgaccggccgcgccgaccgggtcgtg
ggcctgcacttcttcaatcccgtcccggtgctgccgctggtggaggtcgtggcctccctg
cacacgtcggctgcgacagccgccgcagccgaggacttcgccaccggcacgctcggcaag
accgtgatccgctcccaggaccgggcgggattcgtcgtcaacgccctgctcgtcccctac
ctgctgtccgcgatccggatggcggagtccggcttcgccatcgccgccgacatcgacatc
ggcatggaactgggctgcgcccaccccatggggccgctgaaactcgcggacctgatcggt
ctggacaccgtcgcctcgatcgccgagtcgctctacgacgagttcaaggaacctctttac
gcccctcccccgctgctccagcggatggtcgaggcgggactgctgggccgcaagaccggc
cggggcttccacacctacgaccgggactga

DBGET integrated database retrieval system