KEGG   Streptomyces coelicolor: SCO0985Help
Entry
SCO0985           CDS       T00085                                 

Gene name
metE, SCBAC19F3.12
Definition
(RefSeq) 5-methyltetrahydropteroyltriglutamate/homocysteine S-methyltransferase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
sco  Streptomyces coelicolor
Pathway
sco00270  Cysteine and methionine metabolism
sco00450  Selenocompound metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO0985 (metE)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO0985 (metE)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     SCO0985 (metE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1
Motif
Other DBs
NCBI-GeneID: 1096408
NCBI-ProteinID: NP_625281
Kitasato: SCO0985
UniProt: Q93J59
Position
1038243..1040561
Genome map
AA seq 772 aa AA seqDB search
MTAKSAAAAARATVYGYPRQGPNRELKKAIEGYWKGRVSAPELRSLAADLRAANWRRLAD
AGIDEVPAGDFSYYDHVLDTTVMVGAIPERHRAAVAADALDGYFAMARGTQEVAPLEMTK
WFDTNYHYLVPELGPDTVFTADSTKQVTELAEAVALGLTARPVLVGPVTYLLLAKPAPGA
PADFEPLTLLDRLLPVYAEVLTDLRAAGAEWVQLDEPAFVQDRTPAELNALERAYRELGA
LTDRPKLLVASYFDRLGDALPVLAKAPIEGLALDFTDAAATNLDALAAVGGLPGKRLVAG
VVNGRNIWINDLQKSLSTLGTLLGLADRVDVSASCSLLHVPLDTGAERDIEPQILRWLAF
ARQKTAEIVTLAKGLAQGTDAITGELAASRADMASRAGSPITRNPAVRARAEAVTDDDAR
RSQPYAERTAAQRAHLGLPPLPTTTIGSFPQTGEIRAARADLRDGRIDIAGYEERIRAEI
QEVISFQEKTGLDVLVHGEPERNDMVQYFAEQLTGYLATQHGWVQSYGTRYVRPPILAGD
ISRPEPMTVRWTTYAQSLTEKPVKGMLTGPVTMLAWSFVRDDQPLGDTARQVALALRDEV
NDLEAAGTSVIQVDEPALRETLPLRAADHTAYLAWATEAFRLTTSGVRPDTQIHTHMCYA
EFGDIVQAIDDLDADVISLEAARSHMQVAHELATHGYPREAGPGVYDIHSPRVPSAEEAA
ALLRTGLKAIPAERLWVNPDCGLKTRGWPETRASLENLVATARTLRGELSAS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgaagtccgcagccgcggcagcacgggccaccgtgtacggctacccccgccag
ggcccgaaccgggaactgaagaaggcgatcgagggctactggaagggccgcgtcagcgcg
cccgaactccggtccctcgccgcggacctgcgcgccgcgaactggcgccgactggccgac
gccggcatcgacgaggtgcccgccggcgacttctcgtactacgaccacgtcctcgacacc
accgtcatggtcggtgcgatccccgagcgccaccgcgccgccgtcgcggccgacgccctg
gacggctacttcgccatggcccgcggcacccaggaggtcgcgccgctggagatgaccaag
tggttcgacaccaactaccactatctggttccggagttgggtccggacaccgtcttcacg
gccgactccaccaagcaggtcaccgagctggcggaagccgtcgccctgggcctgaccgcc
cgccccgtgctggtcggcccggtcacctatctcctgctggccaagccggcccccggcgcc
cccgcggacttcgagccgctcaccctgctcgaccggctcctgccggtgtacgccgaggtc
ctcaccgacctgcgcgcggccggcgccgagtgggtccagctggacgagcccgccttcgtg
caggaccgcaccccggcggaactgaacgccctggaacgcgcctaccgggaactcggcgcc
ctgaccgaccggcccaagctgctcgtcgcctcctacttcgaccgcctcggcgacgcgctg
cccgtcctggccaaggcaccgatcgagggtcttgccctggacttcaccgacgccgccgcg
accaacctggacgccttggccgccgtcggcggactgcccggcaagcgcctcgtcgccggt
gtcgtcaacggccgcaacatctggatcaacgacctgcagaagtcgttgtccacgctcggc
acgctgctgggtctcgcggaccgggtcgacgtgtccgcctcctgctccctcctccatgtg
cccctcgacaccggggcggagcgggacatcgagccgcagatcctgcgctggctggccttc
gcccggcagaagaccgccgagatcgtcaccctcgccaagggcctcgcccagggcaccgac
gccatcaccggcgaactcgccgccagccgcgccgacatggcctcccgcgccggctcaccg
atcacccgcaacccggccgtacgagcccgtgccgaggccgtgacggacgacgacgcccgt
cgctcccagccgtacgccgaacggaccgccgcccagcgggcacacctggggctgccgccg
ctgccgaccacgaccatcggctcgttcccgcagaccggcgagatccgggccgcccgtgcc
gacctgcgcgacggccgcatcgacatcgccggctacgaggaacggatccgggccgagatc
caggaggtgatctccttccaggagaagaccggcctggacgtcctggtgcacggcgagccc
gaacgcaacgacatggtccagtacttcgccgaacagctgaccgggtatctggccacgcag
cacggctgggtccagtcctacggcacccgctacgtccgcccgccgatcctggccggggac
atctcccgccccgagccgatgacggtgcgctggacgacgtacgcccagtcgctcaccgag
aagccggtcaagggcatgctcaccggcccggtgaccatgctcgcatggtccttcgtccgc
gacgaccagcccctcggtgacaccgcccgccaggtcgccctcgccctgcgcgacgaggtg
aacgacctggaggcggccgggacctcggtcatccaggtcgacgaacccgccctgcgcgag
acactgccgctgcgggccgccgaccacaccgcctacctggcctgggcgacggaggcgttc
cggctgaccacctctggcgtccgcccggacacccagatccacacccacatgtgctacgcc
gagttcggcgacatcgtccaggccatcgacgacctcgacgccgacgtcatcagcctggaa
gccgctcgctcacacatgcaggtagcccacgaactcgctacccacggctacccgcgcgaa
gccggacccggcgtgtacgacatccactccccgcgcgtcccgagcgccgaggaagccgcc
gcactgctgcgcaccggcctcaaggcgattcctgccgaacggctgtgggtcaaccccgac
tgcggtctgaagacccgcggctggcccgagacccgcgcctccctggagaacctggtcgcc
accgcccgcaccctccgcggagagctgtccgcttcctga

DBGET integrated database retrieval system