KEGG   Streptomyces coelicolor: SCO1012Help
Entry
SCO1012           CDS       T00085                                 

Gene name
2SCG2.25c
Definition
(RefSeq) oxidoreductase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sco  Streptomyces coelicolor
Pathway
sco00072  Synthesis and degradation of ketone bodies
sco00650  Butanoate metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO1012 (2SCG2.25c)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SCO1012 (2SCG2.25c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SCO1012 (2SCG2.25c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase NAD_binding_10 KR ApbA 2-Hacid_dh_C F420_oxidored Ldh_1_N 3Beta_HSD 3HCDH_N NmrA RmlD_sub_bind GDP_Man_Dehyd THF_DHG_CYH_C
Motif
Other DBs
NCBI-GeneID: 1096435
NCBI-ProteinID: NP_625308
Kitasato: SCO1012
UniProt: Q9EX28
Position
complement(1068298..1069098)
Genome map
AA seq 266 aa AA seqDB search
MTSPSVLQAPHASSLDLHGRTALVTGAAGGIGRACALRLAAAGAEVRAVDRDAAGLEALA
GSCGDLAGSVEPQVLDLTDLDAAERAAAGTDVLVNNAGLQLVRPLEEFPPDVFHTVLTVM
LEAPFRLIRGALPHMYGQGWGRIVNISSVHGLRASAYKAAYVSAKHGLEGLSKTAALEGA
AHGVTSNCVNPAYVRTPLVERQIADQARAHGLPEEQVLSDVLLRDSALRRLIEPDEVAEA
VAYLCGPYTVGLTGTSLVLDGGWTAH
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcccagcgtcctccaggccccccacgcctcctcgctcgacctgcacggccgc
accgccctcgtcaccggcgccgccggcggcatcggccgcgcctgcgcactgcggctggcc
gcggccggggccgaggtcagagcggtcgaccgggacgccgccggtctcgaggcgctcgcc
ggcagctgcggggacctcgccggcagcgtcgagccgcaggtcctcgacctgaccgacctg
gacgccgccgaacgcgcagcggccggcaccgacgtcctcgtcaacaacgccgggctgcaa
ctggtgcggcctctggaggagttcccgccggacgtcttccacaccgtgctcaccgtgatg
ctggaggcccccttccggctgatccgcggcgccctgccccacatgtacgggcagggctgg
ggccgcatcgtcaacatctcctccgtccacggtctgcgggcctccgcctacaaggccgcc
tatgtgtccgccaagcacgggctggagggactgtccaagaccgccgccctcgaaggcgcc
gcccacggcgtcacctccaactgcgtgaaccccgcctacgtccgcaccccgctggtggag
cggcagatcgccgaccaggcccgggcccacgggctccccgaggagcaggtgctctccgac
gtactgctgcgcgacagcgccctgcggcggctgatcgaacccgacgaggtcgccgaagcg
gtggcatacctgtgcggcccgtacacggtaggcctcacgggcacctcactcgtcctggac
ggcggctggaccgcgcactga

DBGET integrated database retrieval system