KEGG   Streptomyces coelicolor: SCO1028Help
Entry
SCO1028           CDS       T00085                                 

Gene name
SCG20A.08c
Definition
(RefSeq) lyase
  KO
K01738  cysteine synthase A [EC:2.5.1.47]
Organism
sco  Streptomyces coelicolor
Pathway
sco00270  Cysteine and methionine metabolism
sco00920  Sulfur metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SCO1028 (SCG20A.08c)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO1028 (SCG20A.08c)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     SCO1028 (SCG20A.08c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 1096451
NCBI-ProteinID: NP_625323
Kitasato: SCO1028
UniProt: Q9K3N2
Position
complement(1085859..1086983)
Genome map
AA seq 374 aa AA seqDB search
MSTDRQTGTGTTLDVDRSDASYRAWLKEAVRKVQADANRSADTHLLLFPLPEHWGIDLYL
KDESTHPTGSLKHRLARSLFLYGLCNGWIRPDRPVIEASSGSTAVSEAYFAKLVGVPFIA
VMPRTTSAEKIRLIEFHGGRCHFVDDSRRMYEESARLAAETGGHYMDQFTYAERATDWRG
NNNIAESIFRQLRLERYPEPSWIVATAGTGGTSATLARYVHYMQYDTRVCVADPDNSCFF
EGWTTGDPDVACDRGSRIEGIGRPRMEPSFVPGAIDRMMKVPDAASVAAVRSLERAIGRR
AGGSTGTGLWSALKIVAEMVAAGERGSVVTLLCDPGDRYLDKYYSDAWLAEQGLDIEPYT
AAIESLLRTGSLLD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactgaccgacagaccggcaccggcaccaccctcgacgtcgaccgcagcgacgcc
tcctaccgtgcctggctgaaagaggccgtccgcaaggtccaggccgacgcgaaccgctcg
gccgacacccacctgctcctgttcccgctccccgagcactggggcatcgacctgtacctg
aaggacgagtcgacccacccgaccggcagcctcaagcaccggctcgcccgctccctgttc
ctctacggcctgtgcaacggctggatccggccggaccgcccggtgatcgaggcgtccagc
ggctcgacggccgtctccgaggcctatttcgccaagctggtcggcgtccccttcatcgcc
gtcatgccccggacgacgagcgccgagaagatccggctgatcgagttccacgggggacgg
tgccacttcgtggacgactcccggcggatgtacgaggagtcggcccgcctcgcggcggag
accggcggccactacatggaccagttcacctacgccgaacgcgccacggactggcgcggc
aacaacaacatcgccgagtcgatcttccgtcagctgcggctggaacggtatcccgagccg
tcctggatcgtcgccacggccggcaccggcggcacctcggcgaccctcgcccgctacgtc
cactacatgcagtacgacacccgcgtctgcgtcgccgacccggacaactcctgcttcttc
gagggttggaccaccggcgaccccgacgtggcctgcgaccgcggctcccgcatcgagggc
atcggccggccccggatggaaccgagcttcgtacccggcgcgatcgaccgcatgatgaag
gtgccggacgcggccagcgtcgcggccgtgcggtccctggagcgggccatcggccgcagg
gcgggcggctccaccggcaccgggctgtggagcgcgttgaagatcgtcgccgagatggtg
gccgcgggggagcggggcagcgtcgtgacactgctgtgcgatccgggggaccggtacctc
gacaagtactactcggacgcctggctcgccgaacagggcctcgacatcgagccgtacacg
gcggcgatcgagtccctgctgcgcaccggcagcctgctcgactga

DBGET integrated database retrieval system